Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0R0LXF6

Protein Details
Accession A0A0R0LXF6    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MSRWPNKSKRSKIPKQKLLTISTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 13, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR015418  Eaf6  
Gene Ontology GO:0000123  C:histone acetyltransferase complex  
GO:0005634  C:nucleus  
GO:0016740  F:transferase activity  
GO:0006325  P:chromatin organization  
GO:0016573  P:histone acetylation  
Pfam View protein in Pfam  
PF09340  NuA4  
Amino Acid Sequences MSRWPNKSKRSKIPKQKLLTISTRLNELLTRRTQLLKEKSELEKNIYKLETEYLELGQGNPITTSLDAYLGTRGEKKKYVVNAKDRLFSTLLPRVYRDGSND
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.87
3 0.86
4 0.82
5 0.77
6 0.72
7 0.67
8 0.61
9 0.52
10 0.47
11 0.38
12 0.33
13 0.29
14 0.25
15 0.25
16 0.22
17 0.23
18 0.22
19 0.25
20 0.27
21 0.33
22 0.38
23 0.36
24 0.36
25 0.39
26 0.42
27 0.45
28 0.43
29 0.39
30 0.37
31 0.34
32 0.35
33 0.3
34 0.26
35 0.21
36 0.21
37 0.16
38 0.12
39 0.12
40 0.08
41 0.09
42 0.09
43 0.08
44 0.08
45 0.07
46 0.07
47 0.06
48 0.06
49 0.06
50 0.06
51 0.07
52 0.06
53 0.06
54 0.06
55 0.07
56 0.08
57 0.08
58 0.09
59 0.14
60 0.16
61 0.2
62 0.23
63 0.25
64 0.29
65 0.37
66 0.47
67 0.5
68 0.57
69 0.62
70 0.62
71 0.66
72 0.6
73 0.55
74 0.46
75 0.39
76 0.37
77 0.35
78 0.37
79 0.32
80 0.34
81 0.34
82 0.36