Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0R0M3P2

Protein Details
Accession A0A0R0M3P2    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
13-33IQECLTCKLNKKRVNKYGKLLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17.5, mito_nucl 12.166, cyto_nucl 10.833, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001584  Integrase_cat-core  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
GO:0015074  P:DNA integration  
PROSITE View protein in PROSITE  
PS50994  INTEGRASE  
Amino Acid Sequences MPNISHDDVKRVIQECLTCKLNKKRVNKYGKLLGTLDYSKPWDSLAIDLIGPLKREGESKESQILHIMDMGSRLSMTKVLKRADSREISDILEREWFNIYPLPSKILSDNGKVFTSKIYFHSTK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.3
3 0.34
4 0.36
5 0.32
6 0.39
7 0.48
8 0.55
9 0.58
10 0.64
11 0.69
12 0.75
13 0.83
14 0.8
15 0.77
16 0.77
17 0.71
18 0.65
19 0.55
20 0.47
21 0.4
22 0.36
23 0.29
24 0.22
25 0.22
26 0.19
27 0.18
28 0.16
29 0.13
30 0.12
31 0.12
32 0.11
33 0.1
34 0.09
35 0.09
36 0.11
37 0.1
38 0.1
39 0.09
40 0.09
41 0.08
42 0.1
43 0.12
44 0.16
45 0.17
46 0.18
47 0.23
48 0.23
49 0.22
50 0.24
51 0.22
52 0.16
53 0.15
54 0.13
55 0.08
56 0.08
57 0.08
58 0.05
59 0.05
60 0.05
61 0.05
62 0.08
63 0.1
64 0.13
65 0.19
66 0.21
67 0.25
68 0.28
69 0.31
70 0.36
71 0.38
72 0.37
73 0.34
74 0.34
75 0.31
76 0.31
77 0.28
78 0.21
79 0.22
80 0.19
81 0.17
82 0.18
83 0.17
84 0.16
85 0.19
86 0.19
87 0.19
88 0.2
89 0.22
90 0.2
91 0.21
92 0.21
93 0.26
94 0.28
95 0.29
96 0.32
97 0.32
98 0.33
99 0.32
100 0.31
101 0.28
102 0.27
103 0.24
104 0.24