Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0R0M0U3

Protein Details
Accession A0A0R0M0U3    Localization Confidence High Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
73-105KTITAQSKKKWINKKKRPERGITKKNTSRPFFCHydrophilic
NLS Segment(s)
PositionSequence
80-97KKKWINKKKRPERGITKK
Subcellular Location(s) nucl 25
Family & Domain DBs
Amino Acid Sequences MFDDHSEANYNDICEIQRQLVCKSEKIHQLHRIIDNLILKIEDKTAVNGHSAQRVEKQNIFEDDYQPQKSELKTITAQSKKKWINKKKRPERGITKKNTSRPFFC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.16
3 0.17
4 0.17
5 0.19
6 0.21
7 0.27
8 0.29
9 0.3
10 0.31
11 0.34
12 0.41
13 0.43
14 0.5
15 0.5
16 0.52
17 0.54
18 0.53
19 0.48
20 0.41
21 0.39
22 0.33
23 0.25
24 0.21
25 0.16
26 0.13
27 0.12
28 0.12
29 0.1
30 0.08
31 0.09
32 0.1
33 0.1
34 0.11
35 0.13
36 0.13
37 0.15
38 0.16
39 0.15
40 0.19
41 0.22
42 0.24
43 0.25
44 0.26
45 0.25
46 0.27
47 0.3
48 0.25
49 0.24
50 0.24
51 0.26
52 0.25
53 0.22
54 0.21
55 0.21
56 0.2
57 0.22
58 0.2
59 0.2
60 0.21
61 0.25
62 0.33
63 0.38
64 0.42
65 0.4
66 0.49
67 0.53
68 0.59
69 0.66
70 0.68
71 0.71
72 0.78
73 0.87
74 0.88
75 0.91
76 0.9
77 0.9
78 0.9
79 0.9
80 0.9
81 0.89
82 0.88
83 0.86
84 0.88
85 0.87