Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0R0M715

Protein Details
Accession A0A0R0M715    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
16-103LKYLNKESKKTHKESKKTHKESKKLTKNQKKLTKNQKNLTKNQKNLTKNQKNLTKNKKNSQRIKKKHTKNQKISSKNQKKTHKESENIHydrophilic
NLS Segment(s)
PositionSequence
21-97KESKKTHKESKKTHKESKKLTKNQKKLTKNQKNLTKNQKNLTKNQKNLTKNKKNSQRIKKKHTKNQKISSKNQKKTH
Subcellular Location(s) nucl 21.5, cyto_nucl 13.5, mito 3
Family & Domain DBs
Amino Acid Sequences MDLFFMRIFNESERILKYLNKESKKTHKESKKTHKESKKLTKNQKKLTKNQKNLTKNQKNLTKNQKNLTKNKKNSQRIKKKHTKNQKISSKNQKKTHKESENISTKNQKIS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.22
3 0.23
4 0.27
5 0.33
6 0.41
7 0.44
8 0.46
9 0.52
10 0.62
11 0.67
12 0.69
13 0.69
14 0.7
15 0.74
16 0.81
17 0.84
18 0.85
19 0.85
20 0.88
21 0.87
22 0.86
23 0.86
24 0.87
25 0.86
26 0.84
27 0.87
28 0.87
29 0.87
30 0.89
31 0.88
32 0.84
33 0.83
34 0.85
35 0.85
36 0.83
37 0.82
38 0.81
39 0.78
40 0.79
41 0.8
42 0.77
43 0.71
44 0.7
45 0.7
46 0.63
47 0.65
48 0.68
49 0.65
50 0.62
51 0.64
52 0.65
53 0.64
54 0.71
55 0.73
56 0.73
57 0.73
58 0.77
59 0.81
60 0.82
61 0.86
62 0.87
63 0.87
64 0.87
65 0.89
66 0.9
67 0.9
68 0.91
69 0.92
70 0.92
71 0.91
72 0.91
73 0.91
74 0.89
75 0.88
76 0.89
77 0.89
78 0.87
79 0.86
80 0.86
81 0.85
82 0.86
83 0.87
84 0.85
85 0.8
86 0.76
87 0.77
88 0.77
89 0.7
90 0.67
91 0.65