Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0R0M6E7

Protein Details
Accession A0A0R0M6E7    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MTKQTKRGQYHSKLKNTKFKKYNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito_nucl 13.333, mito 11.5, cyto_nucl 8.333
Family & Domain DBs
Amino Acid Sequences MTKQTKRGQYHSKLKNTKFKKYNILKPLQRCHALLMDWRMKTEVINVPFFKNKFVFLKKMSLYSTCYRLHICLIGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.84
3 0.8
4 0.8
5 0.77
6 0.73
7 0.73
8 0.73
9 0.75
10 0.73
11 0.76
12 0.72
13 0.73
14 0.74
15 0.69
16 0.63
17 0.53
18 0.47
19 0.39
20 0.33
21 0.29
22 0.27
23 0.27
24 0.24
25 0.24
26 0.22
27 0.2
28 0.2
29 0.21
30 0.21
31 0.18
32 0.22
33 0.23
34 0.25
35 0.29
36 0.3
37 0.29
38 0.23
39 0.24
40 0.27
41 0.3
42 0.34
43 0.32
44 0.4
45 0.38
46 0.41
47 0.4
48 0.35
49 0.36
50 0.35
51 0.38
52 0.32
53 0.34
54 0.32
55 0.31
56 0.31