Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0R0M1L0

Protein Details
Accession A0A0R0M1L0    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
2-28MYPTNKKVRVYCRKCEKLKKQHIVGTSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito_nucl 12, mito 10.5, cyto 2, pero 2, cyto_pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences EMYPTNKKVRVYCRKCEKLKKQHIVGTSQNGGYKVMVWGCFSFNGVGKIIIIRDKLNAAKYINILANNLRESAEMHHMDNFIFQQDRAPPHTAKITSNWLRDQNIPVLDWALQSPDMNLI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.84
3 0.88
4 0.88
5 0.88
6 0.91
7 0.9
8 0.86
9 0.82
10 0.76
11 0.71
12 0.65
13 0.6
14 0.51
15 0.43
16 0.38
17 0.33
18 0.3
19 0.24
20 0.19
21 0.15
22 0.13
23 0.12
24 0.12
25 0.12
26 0.12
27 0.12
28 0.13
29 0.12
30 0.11
31 0.12
32 0.11
33 0.1
34 0.09
35 0.1
36 0.1
37 0.11
38 0.1
39 0.09
40 0.09
41 0.11
42 0.13
43 0.14
44 0.16
45 0.14
46 0.14
47 0.14
48 0.16
49 0.15
50 0.14
51 0.13
52 0.12
53 0.13
54 0.13
55 0.13
56 0.11
57 0.1
58 0.1
59 0.12
60 0.17
61 0.16
62 0.16
63 0.17
64 0.17
65 0.17
66 0.17
67 0.15
68 0.11
69 0.1
70 0.09
71 0.11
72 0.15
73 0.19
74 0.22
75 0.26
76 0.24
77 0.27
78 0.33
79 0.31
80 0.29
81 0.3
82 0.36
83 0.38
84 0.42
85 0.44
86 0.43
87 0.44
88 0.45
89 0.45
90 0.41
91 0.36
92 0.32
93 0.28
94 0.25
95 0.22
96 0.2
97 0.17
98 0.13
99 0.13
100 0.12