Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0R0LQR9

Protein Details
Accession A0A0R0LQR9    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MYPTNKKVRVYCRKCEKLKKQHIVGTSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 10, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
Amino Acid Sequences MYPTNKKVRVYCRKCEKLKKQHIVGTSQNGGYKVMVWGCFSFNGVGKIIIIRDKLNAAKYINILANNLRESAEMNHMDNFIFQQDRAPPH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.87
3 0.88
4 0.87
5 0.91
6 0.9
7 0.85
8 0.81
9 0.74
10 0.69
11 0.63
12 0.58
13 0.49
14 0.41
15 0.36
16 0.31
17 0.28
18 0.22
19 0.18
20 0.13
21 0.12
22 0.11
23 0.1
24 0.11
25 0.11
26 0.11
27 0.11
28 0.1
29 0.1
30 0.1
31 0.09
32 0.09
33 0.08
34 0.08
35 0.08
36 0.09
37 0.09
38 0.08
39 0.09
40 0.11
41 0.13
42 0.14
43 0.17
44 0.16
45 0.17
46 0.17
47 0.19
48 0.19
49 0.17
50 0.17
51 0.16
52 0.19
53 0.18
54 0.17
55 0.15
56 0.13
57 0.15
58 0.16
59 0.2
60 0.19
61 0.2
62 0.21
63 0.21
64 0.21
65 0.19
66 0.18
67 0.15
68 0.14
69 0.13
70 0.16