Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0R0M7J2

Protein Details
Accession A0A0R0M7J2    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
72-94EKVALSEKKKEIKKKKNRSVSEIHydrophilic
NLS Segment(s)
PositionSequence
79-89KKKEIKKKKNR
Subcellular Location(s) nucl 14, mito 12
Family & Domain DBs
InterPro View protein in InterPro  
IPR043502  DNA/RNA_pol_sf  
IPR043128  Rev_trsase/Diguanyl_cyclase  
Amino Acid Sequences MRSNSFIPSHLQKSIYVNFLKGNRAIVHDKHKNNIEEVIRRLDKNNFRINPLKIQFCQNEVKILRMIINGEEKVALSEKKKEIKKKKNRSVSEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.38
3 0.32
4 0.29
5 0.3
6 0.31
7 0.32
8 0.27
9 0.27
10 0.22
11 0.26
12 0.3
13 0.29
14 0.36
15 0.42
16 0.43
17 0.45
18 0.5
19 0.46
20 0.43
21 0.44
22 0.39
23 0.35
24 0.35
25 0.37
26 0.32
27 0.32
28 0.33
29 0.34
30 0.36
31 0.38
32 0.44
33 0.38
34 0.4
35 0.45
36 0.45
37 0.46
38 0.43
39 0.41
40 0.33
41 0.38
42 0.34
43 0.33
44 0.35
45 0.27
46 0.32
47 0.28
48 0.29
49 0.25
50 0.24
51 0.22
52 0.18
53 0.18
54 0.13
55 0.17
56 0.15
57 0.15
58 0.14
59 0.13
60 0.14
61 0.16
62 0.16
63 0.14
64 0.22
65 0.28
66 0.37
67 0.44
68 0.54
69 0.62
70 0.71
71 0.79
72 0.83
73 0.88
74 0.9