Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0R0M4E1

Protein Details
Accession A0A0R0M4E1    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-25LSTRLKPFYDKIKQKKRKIIISDEEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 10.333, cyto 8, cyto_mito 7.833, mito 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043502  DNA/RNA_pol_sf  
IPR041577  RT_RNaseH_2  
Pfam View protein in Pfam  
PF17919  RT_RNaseH_2  
Amino Acid Sequences LSTRLKPFYDKIKQKKRKIIISDEEMKIIKEINKDLKEKFHLYFPDLNEPFFINTDASETGIGAVLYQTEGIIGYFSKTLNECQMKYSVVGLIGLLDCLFLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.9
3 0.88
4 0.87
5 0.84
6 0.82
7 0.79
8 0.76
9 0.74
10 0.65
11 0.59
12 0.49
13 0.42
14 0.33
15 0.27
16 0.22
17 0.17
18 0.2
19 0.26
20 0.31
21 0.33
22 0.35
23 0.38
24 0.4
25 0.4
26 0.36
27 0.33
28 0.3
29 0.3
30 0.33
31 0.3
32 0.35
33 0.32
34 0.31
35 0.26
36 0.25
37 0.22
38 0.18
39 0.17
40 0.07
41 0.07
42 0.08
43 0.08
44 0.08
45 0.07
46 0.06
47 0.06
48 0.06
49 0.06
50 0.04
51 0.04
52 0.03
53 0.04
54 0.04
55 0.03
56 0.03
57 0.03
58 0.03
59 0.04
60 0.04
61 0.05
62 0.06
63 0.06
64 0.08
65 0.09
66 0.11
67 0.19
68 0.24
69 0.24
70 0.26
71 0.28
72 0.27
73 0.27
74 0.26
75 0.19
76 0.15
77 0.14
78 0.12
79 0.11
80 0.1
81 0.09
82 0.08