Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0R0LWL3

Protein Details
Accession A0A0R0LWL3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MTWVPNKKFKKYKNNMYFKSHLHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, plas 5, golg 4, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTWVPNKKFKKYKNNMYFKSHLHLIVFYLFMIIFFKCMQFNNYACFLIMISLSFQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.85
3 0.83
4 0.78
5 0.69
6 0.63
7 0.54
8 0.44
9 0.34
10 0.28
11 0.21
12 0.17
13 0.15
14 0.1
15 0.08
16 0.06
17 0.06
18 0.06
19 0.05
20 0.06
21 0.06
22 0.07
23 0.08
24 0.09
25 0.11
26 0.15
27 0.17
28 0.19
29 0.22
30 0.21
31 0.2
32 0.2
33 0.18
34 0.14
35 0.13