Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0R0LU46

Protein Details
Accession A0A0R0LU46    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
80-100NPPIKTSKKAGRPIKNTNKATHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16.5, cyto_nucl 11.833, mito_nucl 11.666, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007527  Znf_SWIM  
Gene Ontology GO:0008270  F:zinc ion binding  
PROSITE View protein in PROSITE  
PS50966  ZF_SWIM  
Amino Acid Sequences MKTEITDQHDTVDIKTFLNTPRNSLKELKSFFNRVCYVDIPSICNFLKNIYCTCSVYCREKQCRHLYSVLRDAKMSCFYNPPIKTSKKAGRPIKNTNKATSEYFKKRLTCLEGVNPFSAWHTKME
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.24
4 0.24
5 0.32
6 0.32
7 0.3
8 0.38
9 0.4
10 0.43
11 0.45
12 0.45
13 0.45
14 0.48
15 0.49
16 0.46
17 0.48
18 0.45
19 0.47
20 0.44
21 0.37
22 0.37
23 0.32
24 0.29
25 0.29
26 0.28
27 0.24
28 0.23
29 0.25
30 0.22
31 0.21
32 0.18
33 0.16
34 0.18
35 0.17
36 0.17
37 0.16
38 0.18
39 0.18
40 0.19
41 0.21
42 0.22
43 0.26
44 0.3
45 0.36
46 0.43
47 0.47
48 0.54
49 0.58
50 0.58
51 0.55
52 0.56
53 0.51
54 0.47
55 0.51
56 0.47
57 0.39
58 0.36
59 0.34
60 0.29
61 0.31
62 0.27
63 0.19
64 0.18
65 0.2
66 0.29
67 0.29
68 0.3
69 0.32
70 0.34
71 0.36
72 0.42
73 0.48
74 0.48
75 0.57
76 0.64
77 0.67
78 0.72
79 0.79
80 0.82
81 0.84
82 0.79
83 0.74
84 0.68
85 0.61
86 0.58
87 0.55
88 0.53
89 0.51
90 0.54
91 0.55
92 0.53
93 0.53
94 0.54
95 0.53
96 0.48
97 0.45
98 0.48
99 0.49
100 0.5
101 0.49
102 0.42
103 0.36
104 0.34
105 0.32