Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0R0LYR8

Protein Details
Accession A0A0R0LYR8    Localization Confidence Low Confidence Score 8.1
NoLS Segment(s)
PositionSequenceProtein Nature
65-84ADRLRHVRSISVRKEKKRYCBasic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito_nucl 13.833, mito 11.5, cyto_nucl 8.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR043502  DNA/RNA_pol_sf  
IPR041373  RT_RNaseH  
Pfam View protein in Pfam  
PF17917  RT_RNaseH  
Amino Acid Sequences LFVIKSLEHCRHYLLRKQFTLRTDHQALIHMQKSKNHMIRLIPWSLKLKEYDLRIKYIKGSENGADRLRHVRSISVRKEKKRYC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.54
3 0.57
4 0.61
5 0.61
6 0.56
7 0.58
8 0.53
9 0.51
10 0.46
11 0.42
12 0.38
13 0.36
14 0.35
15 0.32
16 0.32
17 0.29
18 0.27
19 0.29
20 0.33
21 0.38
22 0.41
23 0.37
24 0.35
25 0.32
26 0.36
27 0.36
28 0.35
29 0.27
30 0.25
31 0.28
32 0.26
33 0.26
34 0.22
35 0.21
36 0.21
37 0.26
38 0.32
39 0.29
40 0.33
41 0.32
42 0.32
43 0.32
44 0.33
45 0.33
46 0.26
47 0.28
48 0.27
49 0.3
50 0.33
51 0.33
52 0.3
53 0.28
54 0.32
55 0.31
56 0.31
57 0.27
58 0.3
59 0.36
60 0.45
61 0.53
62 0.58
63 0.65
64 0.71