Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0R0LQX3

Protein Details
Accession A0A0R0LQX3    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
63-84THILRISSRKTNEKKKEVRKEVHydrophilic
NLS Segment(s)
PositionSequence
76-78KKK
Subcellular Location(s) mito 17, nucl 9, cyto_mito 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR045077  L3_arc_euk  
IPR000597  Ribosomal_L3  
IPR044892  Ribosomal_L3_dom_3_arc_sf  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00297  Ribosomal_L3  
Amino Acid Sequences MIFWLTLRKMSCRKFEAPRHGSLAYCPKKRASSIKQREPAVPKDNVSDKPHLTSFLSYKVGMTHILRISSRKTNEKKKEVRKEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.67
3 0.71
4 0.67
5 0.65
6 0.63
7 0.57
8 0.5
9 0.45
10 0.46
11 0.44
12 0.43
13 0.4
14 0.39
15 0.4
16 0.44
17 0.49
18 0.48
19 0.5
20 0.57
21 0.65
22 0.67
23 0.67
24 0.68
25 0.63
26 0.6
27 0.54
28 0.46
29 0.37
30 0.34
31 0.36
32 0.35
33 0.34
34 0.32
35 0.27
36 0.29
37 0.28
38 0.27
39 0.24
40 0.21
41 0.19
42 0.2
43 0.21
44 0.18
45 0.18
46 0.17
47 0.17
48 0.17
49 0.17
50 0.18
51 0.18
52 0.2
53 0.21
54 0.23
55 0.27
56 0.33
57 0.38
58 0.42
59 0.5
60 0.59
61 0.68
62 0.76
63 0.82
64 0.84