A0A0R0M145

UniProt ID: A0A0R0M145   Organism: Pseudoloma neurophilia
Gene: M153_1040000388   Protein: Protein kinase of the PI-3 kinase family
Length: 100 AA

Protein Details

• Accession: A0A0R0M145
• Localization Confidence: Low
• Confidence Score: 6.2
• NoLS Segment(s):

  Position	Sequence	Protein Nature
  45-69	FFRCGPKTRGHPNKRSKMNQPCIFI	Hydrophilic

• Subcellular Location(s): mito 20.5, mito_nucl 13.333, nucl 5, cyto_nucl 3.833
• Family & Domain DBs:
  • Gene Ontology:
    • GO:0016301 F:kinase activity
    • GO:0016310 P:phosphorylation
• Amino Acid Sequences: MVRFSAENRIYEIMLPRYKPGRRDSLLIKWRVVGLYYWGDPYAFFFRCGPKTRGHPNKRSKMNQPCIFILKKIIF

NoLS Predictions per Residue - Data Table

Residue Number, Score
1, 0.29
2, 0.29
3, 0.3
4, 0.36
5, 0.38
6, 0.42
7, 0.43
8, 0.44
9, 0.43
10, 0.46
11, 0.48
12, 0.5
13, 0.55
14, 0.52
15, 0.47
16, 0.38
17, 0.36
18, 0.32
19, 0.27
20, 0.17
21, 0.12
22, 0.12
23, 0.12
24, 0.11
25, 0.11
26, 0.1
27, 0.1
28, 0.13
29, 0.14
30, 0.12
31, 0.13
32, 0.15
33, 0.19
34, 0.24
35, 0.3
36, 0.3
37, 0.3
38, 0.37
39, 0.47
40, 0.57
41, 0.62
42, 0.67
43, 0.72
44, 0.8
45, 0.84
46, 0.84
47, 0.84
48, 0.84
49, 0.85
50, 0.82
51, 0.76
52, 0.71
53, 0.68
54, 0.63
55, 0.54