Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0R0LVN5

Protein Details
Accession A0A0R0LVN5    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
124-145DLRKIPCRSFHLRKNCNRKICTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, mito_nucl 12.499, cyto_nucl 10.833, mito 8.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045124  Su(sable)-like  
IPR041367  Znf-CCCH_4  
IPR000571  Znf_CCCH  
IPR036855  Znf_CCCH_sf  
Gene Ontology GO:0046872  F:metal ion binding  
GO:0003723  F:RNA binding  
GO:0045892  P:negative regulation of DNA-templated transcription  
GO:0016070  P:RNA metabolic process  
Pfam View protein in Pfam  
PF18044  zf-CCCH_4  
PROSITE View protein in PROSITE  
PS50103  ZF_C3H1  
Amino Acid Sequences MMKKMAVPTKISADLLVYRNKILKQNQKNALKITAKTSQNSLEEKEVEKLPSLDEIEKLTIPVLEKSSSQENNFQSNSAENESLAKTGYFGKRPRLNYNGQRPICKFYLSNSCTRGENCTFSHDLRKIPCRSFHLRKNCNRKICTYSHEPVSAAVYNKMKEDDMKERKSYISPFH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.29
3 0.31
4 0.27
5 0.26
6 0.3
7 0.33
8 0.37
9 0.41
10 0.49
11 0.53
12 0.62
13 0.69
14 0.73
15 0.74
16 0.7
17 0.69
18 0.63
19 0.55
20 0.5
21 0.49
22 0.44
23 0.42
24 0.41
25 0.38
26 0.37
27 0.38
28 0.35
29 0.3
30 0.29
31 0.29
32 0.29
33 0.26
34 0.23
35 0.21
36 0.19
37 0.16
38 0.17
39 0.17
40 0.15
41 0.14
42 0.15
43 0.15
44 0.15
45 0.14
46 0.11
47 0.1
48 0.1
49 0.11
50 0.11
51 0.1
52 0.11
53 0.13
54 0.19
55 0.2
56 0.21
57 0.26
58 0.27
59 0.3
60 0.3
61 0.28
62 0.23
63 0.21
64 0.22
65 0.17
66 0.15
67 0.11
68 0.12
69 0.12
70 0.11
71 0.1
72 0.08
73 0.07
74 0.11
75 0.14
76 0.17
77 0.19
78 0.27
79 0.33
80 0.37
81 0.42
82 0.42
83 0.48
84 0.51
85 0.6
86 0.62
87 0.57
88 0.59
89 0.55
90 0.55
91 0.48
92 0.41
93 0.3
94 0.24
95 0.33
96 0.31
97 0.34
98 0.31
99 0.32
100 0.32
101 0.32
102 0.34
103 0.26
104 0.27
105 0.24
106 0.26
107 0.27
108 0.27
109 0.34
110 0.31
111 0.32
112 0.34
113 0.42
114 0.42
115 0.43
116 0.48
117 0.47
118 0.54
119 0.59
120 0.63
121 0.65
122 0.7
123 0.76
124 0.81
125 0.83
126 0.83
127 0.78
128 0.75
129 0.7
130 0.66
131 0.63
132 0.6
133 0.56
134 0.52
135 0.5
136 0.44
137 0.39
138 0.37
139 0.34
140 0.27
141 0.28
142 0.26
143 0.26
144 0.27
145 0.28
146 0.25
147 0.25
148 0.3
149 0.36
150 0.41
151 0.47
152 0.48
153 0.49
154 0.5
155 0.52