Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0R0M3R2

Protein Details
Accession A0A0R0M3R2    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
14-41CTNCEICEKLKRKRKCLGFRPRFEKNNNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11.5mito_nucl 11.5, nucl 10.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001584  Integrase_cat-core  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003723  F:RNA binding  
GO:0015074  P:DNA integration  
Pfam View protein in Pfam  
PF00665  rve  
PROSITE View protein in PROSITE  
PS50994  INTEGRASE  
Amino Acid Sequences MNNLWLRDSCYKICTNCEICEKLKRKRKCLGFRPRFEKNNNLQKFSVDICGPFIIEPDCGVHKRVYIITMINSHSKFVKVDVLNDLSATETVKVLKKMFLKMSVPLQLFSDNRVQIRSAVFRDLMQKMGIAYSFSRIYNPRANSKSNELIKQSMSWCGFSL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.42
3 0.41
4 0.46
5 0.45
6 0.44
7 0.52
8 0.55
9 0.57
10 0.63
11 0.68
12 0.68
13 0.73
14 0.8
15 0.81
16 0.84
17 0.85
18 0.86
19 0.87
20 0.87
21 0.86
22 0.83
23 0.77
24 0.76
25 0.74
26 0.74
27 0.68
28 0.65
29 0.56
30 0.5
31 0.47
32 0.39
33 0.32
34 0.22
35 0.18
36 0.15
37 0.15
38 0.15
39 0.12
40 0.11
41 0.09
42 0.08
43 0.08
44 0.08
45 0.1
46 0.11
47 0.13
48 0.12
49 0.12
50 0.14
51 0.14
52 0.13
53 0.12
54 0.12
55 0.12
56 0.14
57 0.15
58 0.18
59 0.17
60 0.17
61 0.16
62 0.16
63 0.14
64 0.13
65 0.18
66 0.14
67 0.15
68 0.17
69 0.19
70 0.18
71 0.17
72 0.16
73 0.1
74 0.1
75 0.09
76 0.06
77 0.05
78 0.07
79 0.09
80 0.11
81 0.11
82 0.15
83 0.18
84 0.21
85 0.23
86 0.26
87 0.25
88 0.26
89 0.29
90 0.31
91 0.28
92 0.25
93 0.24
94 0.24
95 0.22
96 0.23
97 0.25
98 0.21
99 0.21
100 0.21
101 0.21
102 0.19
103 0.22
104 0.24
105 0.2
106 0.2
107 0.2
108 0.21
109 0.26
110 0.25
111 0.23
112 0.19
113 0.18
114 0.15
115 0.16
116 0.15
117 0.11
118 0.1
119 0.12
120 0.14
121 0.14
122 0.17
123 0.19
124 0.24
125 0.31
126 0.34
127 0.4
128 0.43
129 0.47
130 0.49
131 0.54
132 0.58
133 0.56
134 0.57
135 0.52
136 0.5
137 0.48
138 0.47
139 0.41
140 0.4
141 0.35