Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P7AZV9

Protein Details
Accession A0A0P7AZV9    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
3-49SAKQHVPIVKKRTKRFARHQSDRFKCVDPSWRKPKGIDSRVRRRFRGHydrophilic
NLS Segment(s)
PositionSequence
14-16RTK
34-49RKPKGIDSRVRRRFRG
Subcellular Location(s) mito 17.5, mito_nucl 11.833, cyto_nucl 5.333, nucl 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVSAKQHVPIVKKRTKRFARHQSDRFKCVDPSWRKPKGIDSRVRRRFRGAISMPKIGYGSNKKTKFLTPSGHKAFLVSNLKDVELLLMHNRTFAAEIAHNVSSRKRIDIIARAKQLGVKVTNPKAKVTTEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.78
3 0.81
4 0.83
5 0.84
6 0.87
7 0.88
8 0.89
9 0.9
10 0.86
11 0.81
12 0.74
13 0.65
14 0.57
15 0.5
16 0.51
17 0.49
18 0.52
19 0.57
20 0.61
21 0.59
22 0.58
23 0.64
24 0.65
25 0.65
26 0.65
27 0.65
28 0.69
29 0.77
30 0.81
31 0.73
32 0.67
33 0.63
34 0.56
35 0.56
36 0.5
37 0.5
38 0.49
39 0.51
40 0.45
41 0.4
42 0.38
43 0.28
44 0.28
45 0.25
46 0.28
47 0.33
48 0.35
49 0.35
50 0.37
51 0.39
52 0.38
53 0.37
54 0.37
55 0.33
56 0.41
57 0.44
58 0.44
59 0.41
60 0.37
61 0.33
62 0.33
63 0.33
64 0.24
65 0.23
66 0.22
67 0.22
68 0.21
69 0.21
70 0.14
71 0.08
72 0.09
73 0.08
74 0.1
75 0.1
76 0.1
77 0.1
78 0.1
79 0.1
80 0.1
81 0.1
82 0.09
83 0.11
84 0.14
85 0.16
86 0.16
87 0.16
88 0.18
89 0.21
90 0.21
91 0.22
92 0.2
93 0.22
94 0.28
95 0.36
96 0.43
97 0.46
98 0.49
99 0.48
100 0.46
101 0.45
102 0.42
103 0.38
104 0.33
105 0.3
106 0.35
107 0.43
108 0.5
109 0.49
110 0.5
111 0.47