Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P7BIR8

Protein Details
Accession A0A0P7BIR8   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
96-127GLATKRERASRQQRKQRKNRQKTLRGTAKTKGHydrophilic
NLS Segment(s)
PositionSequence
100-134KRERASRQQRKQRKNRQKTLRGTAKTKGAKAKKEK
Subcellular Location(s) mito 15, cyto 7, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MADTPVTLRTRKFIRNPLLGRKQMVVDILHPNRANIAKDELREKLGALYKAQKDQISVFGLRTQFGGGKTTGFALVYDSPEAMKKFEPQYRLVRVGLATKRERASRQQRKQRKNRQKTLRGTAKTKGAKAKKEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.64
3 0.7
4 0.74
5 0.77
6 0.72
7 0.66
8 0.59
9 0.51
10 0.42
11 0.38
12 0.29
13 0.22
14 0.29
15 0.28
16 0.32
17 0.3
18 0.29
19 0.3
20 0.31
21 0.29
22 0.22
23 0.27
24 0.24
25 0.26
26 0.29
27 0.27
28 0.26
29 0.25
30 0.23
31 0.2
32 0.22
33 0.22
34 0.2
35 0.26
36 0.26
37 0.29
38 0.31
39 0.27
40 0.24
41 0.24
42 0.25
43 0.21
44 0.19
45 0.17
46 0.17
47 0.17
48 0.16
49 0.15
50 0.12
51 0.11
52 0.11
53 0.12
54 0.09
55 0.09
56 0.09
57 0.09
58 0.09
59 0.07
60 0.06
61 0.07
62 0.08
63 0.09
64 0.09
65 0.08
66 0.08
67 0.11
68 0.11
69 0.1
70 0.1
71 0.14
72 0.19
73 0.23
74 0.26
75 0.29
76 0.35
77 0.39
78 0.42
79 0.38
80 0.33
81 0.31
82 0.35
83 0.34
84 0.34
85 0.31
86 0.32
87 0.35
88 0.38
89 0.41
90 0.44
91 0.51
92 0.56
93 0.64
94 0.71
95 0.78
96 0.85
97 0.93
98 0.94
99 0.94
100 0.94
101 0.94
102 0.94
103 0.94
104 0.92
105 0.92
106 0.91
107 0.87
108 0.81
109 0.76
110 0.75
111 0.71
112 0.67
113 0.66
114 0.64