Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6FR87

Protein Details
Accession Q6FR87    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
36-56VSNKKSPDSRREKLKNKLDKSHydrophilic
NLS Segment(s)
Subcellular Location(s) E.R. 15, golg 3, vacu 3, nucl 2, cyto 2, extr 2, cyto_nucl 2
Family & Domain DBs
Gene Ontology GO:0005783  C:endoplasmic reticulum  
GO:0016020  C:membrane  
KEGG cgr:CAGL0H10560g  -  
Amino Acid Sequences MDFFKFLIVLVIVVLFILVLPWLSGIGSYSIQKAAVSNKKSPDSRREKLKNKLDKSVALNFSLKDKNDESDGKSSHVSKRGEFDIDSKTGLKRRVLSRYDQDPNNFDFDIDELIDEDRKEEAKEEQQRIKKFGGKSSEAYEGFV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.03
3 0.03
4 0.03
5 0.02
6 0.02
7 0.03
8 0.03
9 0.03
10 0.03
11 0.03
12 0.04
13 0.06
14 0.08
15 0.09
16 0.1
17 0.1
18 0.11
19 0.11
20 0.12
21 0.18
22 0.25
23 0.29
24 0.33
25 0.37
26 0.43
27 0.48
28 0.52
29 0.54
30 0.55
31 0.57
32 0.63
33 0.68
34 0.71
35 0.76
36 0.81
37 0.81
38 0.75
39 0.77
40 0.68
41 0.63
42 0.59
43 0.56
44 0.48
45 0.4
46 0.37
47 0.29
48 0.31
49 0.29
50 0.24
51 0.2
52 0.19
53 0.18
54 0.2
55 0.22
56 0.2
57 0.22
58 0.23
59 0.21
60 0.22
61 0.23
62 0.23
63 0.28
64 0.26
65 0.22
66 0.25
67 0.25
68 0.25
69 0.23
70 0.23
71 0.19
72 0.19
73 0.19
74 0.17
75 0.18
76 0.2
77 0.23
78 0.24
79 0.26
80 0.3
81 0.38
82 0.4
83 0.44
84 0.47
85 0.52
86 0.55
87 0.53
88 0.51
89 0.45
90 0.44
91 0.42
92 0.35
93 0.26
94 0.2
95 0.17
96 0.15
97 0.12
98 0.1
99 0.07
100 0.08
101 0.1
102 0.09
103 0.09
104 0.09
105 0.1
106 0.11
107 0.12
108 0.16
109 0.25
110 0.34
111 0.41
112 0.49
113 0.55
114 0.6
115 0.62
116 0.63
117 0.6
118 0.54
119 0.54
120 0.53
121 0.5
122 0.49
123 0.49
124 0.52