Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P7B8Q7

Protein Details
Accession A0A0P7B8Q7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
98-117PPTIGRRKKLKVPPNARSQSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 20, E.R. 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009447  PIGW/GWT1  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0008374  F:O-acyltransferase activity  
GO:0006506  P:GPI anchor biosynthetic process  
Pfam View protein in Pfam  
PF06423  GWT1  
Amino Acid Sequences MSDSASYKKLKEDFVSNLSGGSVAEINHVTSVAAVACILWSVIQARQSFFQPYTALGFIVDFLLNVGAILLSTTLYADSPVLLSLLLLAPAVLIYIIPPTIGRRKKLKVPPNARSQSGPGQLDVLSTKPFLTTYRGAMMIVTCVAILAVDFRLFPRRFAKVETWGTSLMDLGVGSFVFSGGVVAARPVLRERAAGRTKGQTTPLFYRILYSMRHSIPLLVLGGIRFLSVKGLDYAEHVTEYGVHWNFFFTLGFLPPFVALFQSAFQLVDSFAALSLMIGVTYQILLETTSLKAFILTAPRTDIISMNREGIFSFFGYLAIFLAGQDTGMYAIPRNITKRSKASPGDQRNDLLKMMAVCGGVWTGLYLLSTNYSYGFGLSVSRRMANLPYVLWVVAFNTVQLFGFCIVDTVFFPAFYNAVDSKSEKEAYEKATSPVVRAYNRNGLAVFLLANLLTGAVNLTVRTLDVTPMATVGILVGYMATVTGFAVALDFYNISVKL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.49
3 0.41
4 0.37
5 0.32
6 0.28
7 0.21
8 0.16
9 0.12
10 0.08
11 0.11
12 0.11
13 0.12
14 0.11
15 0.12
16 0.1
17 0.09
18 0.09
19 0.07
20 0.06
21 0.06
22 0.05
23 0.05
24 0.05
25 0.05
26 0.04
27 0.05
28 0.07
29 0.1
30 0.15
31 0.17
32 0.19
33 0.21
34 0.24
35 0.27
36 0.26
37 0.27
38 0.22
39 0.22
40 0.24
41 0.22
42 0.2
43 0.16
44 0.15
45 0.12
46 0.13
47 0.11
48 0.07
49 0.07
50 0.07
51 0.06
52 0.06
53 0.05
54 0.04
55 0.03
56 0.04
57 0.03
58 0.03
59 0.04
60 0.04
61 0.04
62 0.05
63 0.05
64 0.05
65 0.06
66 0.06
67 0.06
68 0.06
69 0.05
70 0.05
71 0.06
72 0.06
73 0.06
74 0.05
75 0.05
76 0.04
77 0.04
78 0.04
79 0.03
80 0.03
81 0.03
82 0.04
83 0.04
84 0.04
85 0.05
86 0.09
87 0.19
88 0.25
89 0.3
90 0.37
91 0.44
92 0.54
93 0.63
94 0.68
95 0.7
96 0.75
97 0.78
98 0.81
99 0.8
100 0.72
101 0.64
102 0.6
103 0.56
104 0.53
105 0.45
106 0.35
107 0.31
108 0.29
109 0.28
110 0.24
111 0.17
112 0.11
113 0.11
114 0.11
115 0.09
116 0.1
117 0.11
118 0.15
119 0.16
120 0.17
121 0.2
122 0.2
123 0.19
124 0.19
125 0.18
126 0.13
127 0.11
128 0.08
129 0.06
130 0.05
131 0.05
132 0.04
133 0.04
134 0.04
135 0.04
136 0.05
137 0.05
138 0.06
139 0.16
140 0.16
141 0.19
142 0.23
143 0.27
144 0.28
145 0.32
146 0.36
147 0.36
148 0.41
149 0.41
150 0.39
151 0.36
152 0.35
153 0.3
154 0.25
155 0.16
156 0.1
157 0.07
158 0.05
159 0.04
160 0.04
161 0.04
162 0.03
163 0.03
164 0.03
165 0.03
166 0.03
167 0.03
168 0.03
169 0.03
170 0.03
171 0.05
172 0.05
173 0.06
174 0.07
175 0.09
176 0.09
177 0.11
178 0.13
179 0.21
180 0.25
181 0.26
182 0.28
183 0.32
184 0.34
185 0.35
186 0.38
187 0.3
188 0.32
189 0.34
190 0.34
191 0.29
192 0.27
193 0.26
194 0.23
195 0.23
196 0.19
197 0.17
198 0.2
199 0.19
200 0.21
201 0.19
202 0.18
203 0.16
204 0.16
205 0.13
206 0.08
207 0.08
208 0.06
209 0.06
210 0.06
211 0.06
212 0.05
213 0.04
214 0.05
215 0.05
216 0.05
217 0.06
218 0.06
219 0.06
220 0.08
221 0.09
222 0.09
223 0.08
224 0.08
225 0.07
226 0.07
227 0.07
228 0.11
229 0.1
230 0.1
231 0.1
232 0.1
233 0.11
234 0.11
235 0.1
236 0.05
237 0.06
238 0.06
239 0.07
240 0.06
241 0.06
242 0.06
243 0.06
244 0.05
245 0.05
246 0.04
247 0.05
248 0.05
249 0.05
250 0.06
251 0.05
252 0.05
253 0.05
254 0.05
255 0.05
256 0.05
257 0.04
258 0.04
259 0.04
260 0.04
261 0.03
262 0.03
263 0.03
264 0.02
265 0.02
266 0.02
267 0.02
268 0.03
269 0.03
270 0.02
271 0.03
272 0.03
273 0.03
274 0.05
275 0.05
276 0.05
277 0.06
278 0.06
279 0.06
280 0.06
281 0.07
282 0.12
283 0.12
284 0.13
285 0.14
286 0.15
287 0.15
288 0.16
289 0.16
290 0.13
291 0.16
292 0.16
293 0.17
294 0.17
295 0.17
296 0.16
297 0.15
298 0.13
299 0.09
300 0.09
301 0.07
302 0.07
303 0.07
304 0.07
305 0.06
306 0.05
307 0.05
308 0.04
309 0.04
310 0.04
311 0.04
312 0.04
313 0.04
314 0.04
315 0.05
316 0.05
317 0.05
318 0.07
319 0.09
320 0.11
321 0.14
322 0.2
323 0.24
324 0.29
325 0.35
326 0.38
327 0.45
328 0.46
329 0.52
330 0.56
331 0.61
332 0.62
333 0.57
334 0.55
335 0.5
336 0.47
337 0.4
338 0.29
339 0.21
340 0.16
341 0.14
342 0.13
343 0.1
344 0.09
345 0.09
346 0.08
347 0.07
348 0.06
349 0.05
350 0.04
351 0.04
352 0.04
353 0.04
354 0.04
355 0.06
356 0.07
357 0.07
358 0.07
359 0.08
360 0.08
361 0.08
362 0.08
363 0.07
364 0.1
365 0.11
366 0.14
367 0.15
368 0.16
369 0.16
370 0.17
371 0.19
372 0.18
373 0.19
374 0.15
375 0.16
376 0.16
377 0.15
378 0.14
379 0.12
380 0.1
381 0.11
382 0.1
383 0.08
384 0.08
385 0.09
386 0.09
387 0.08
388 0.09
389 0.07
390 0.08
391 0.08
392 0.08
393 0.07
394 0.08
395 0.09
396 0.12
397 0.11
398 0.1
399 0.11
400 0.11
401 0.12
402 0.11
403 0.15
404 0.12
405 0.13
406 0.16
407 0.17
408 0.19
409 0.23
410 0.25
411 0.21
412 0.24
413 0.27
414 0.3
415 0.34
416 0.33
417 0.3
418 0.35
419 0.35
420 0.33
421 0.34
422 0.35
423 0.33
424 0.35
425 0.4
426 0.42
427 0.43
428 0.43
429 0.37
430 0.32
431 0.29
432 0.25
433 0.19
434 0.1
435 0.09
436 0.07
437 0.07
438 0.06
439 0.06
440 0.05
441 0.05
442 0.05
443 0.05
444 0.06
445 0.06
446 0.07
447 0.07
448 0.07
449 0.09
450 0.09
451 0.1
452 0.11
453 0.12
454 0.12
455 0.12
456 0.12
457 0.09
458 0.08
459 0.07
460 0.06
461 0.04
462 0.04
463 0.03
464 0.03
465 0.03
466 0.03
467 0.03
468 0.03
469 0.03
470 0.04
471 0.04
472 0.04
473 0.05
474 0.05
475 0.05
476 0.07
477 0.07
478 0.07