Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P7B530

Protein Details
Accession A0A0P7B530   
Localization Confidence High
Confidence Score 24.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-21ISKRKIGSSGLQRRVRPRREBasic
266-286KTPFYLKKSEQKKKILTDRFAHydrophilic
292-314QVDRAIERKRKKVAGKEKKEMGABasic
NLS Segment(s)
PositionSequence
138-140RGK
144-150TPKRSSK
237-244KKKARLRR
295-322RAIERKRKKVAGKEKKEMGALERVRPRG
Subcellular Location(s) nucl 20, mito 4, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009292  RRP36  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0000469  P:cleavage involved in rRNA processing  
Pfam View protein in Pfam  
PF06102  RRP36  
Amino Acid Sequences MISKRKIGSSGLQRRVRPRREDDWEMDPKDAQASSSDDDDDDVEEQTTRRRDHKDASKDDEQTGSEAESGSDGDSEDDDPEPAAPQVDLTSISFGALAKALATLPPPERKSKTSKSASTTTTTTTDAAEPPIPRKATRGKYDPTPKRSSKHAPQEQSSKRPVSRLREIIPDTRRPHRDPRFEPFSGHLDEAKANKAYAFLDEYRDTEMAELRVQIKKARDPDAKDALKRQLLSMESKKKARLRREEADNLLTEHRKREKDLVAQGKTPFYLKKSEQKKKILTDRFASMSKGQVDRAIERKRKKVAGKEKKEMGALERVRPRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.8
3 0.8
4 0.78
5 0.75
6 0.74
7 0.76
8 0.79
9 0.73
10 0.72
11 0.72
12 0.65
13 0.59
14 0.5
15 0.41
16 0.36
17 0.31
18 0.22
19 0.16
20 0.18
21 0.18
22 0.19
23 0.19
24 0.16
25 0.17
26 0.16
27 0.15
28 0.12
29 0.11
30 0.1
31 0.1
32 0.11
33 0.16
34 0.22
35 0.23
36 0.29
37 0.35
38 0.39
39 0.48
40 0.58
41 0.62
42 0.64
43 0.69
44 0.7
45 0.67
46 0.63
47 0.56
48 0.46
49 0.37
50 0.3
51 0.22
52 0.15
53 0.12
54 0.11
55 0.09
56 0.08
57 0.07
58 0.07
59 0.06
60 0.06
61 0.07
62 0.07
63 0.08
64 0.08
65 0.08
66 0.08
67 0.08
68 0.08
69 0.08
70 0.08
71 0.06
72 0.06
73 0.06
74 0.07
75 0.08
76 0.07
77 0.08
78 0.08
79 0.08
80 0.08
81 0.08
82 0.07
83 0.07
84 0.06
85 0.05
86 0.05
87 0.05
88 0.05
89 0.06
90 0.09
91 0.12
92 0.19
93 0.22
94 0.28
95 0.32
96 0.35
97 0.43
98 0.48
99 0.54
100 0.55
101 0.58
102 0.57
103 0.59
104 0.57
105 0.52
106 0.46
107 0.38
108 0.32
109 0.28
110 0.23
111 0.18
112 0.17
113 0.14
114 0.14
115 0.15
116 0.14
117 0.15
118 0.2
119 0.2
120 0.19
121 0.23
122 0.3
123 0.34
124 0.39
125 0.43
126 0.41
127 0.49
128 0.59
129 0.63
130 0.62
131 0.63
132 0.6
133 0.57
134 0.61
135 0.61
136 0.59
137 0.61
138 0.62
139 0.58
140 0.58
141 0.66
142 0.64
143 0.62
144 0.57
145 0.5
146 0.43
147 0.44
148 0.46
149 0.42
150 0.44
151 0.43
152 0.41
153 0.43
154 0.45
155 0.46
156 0.45
157 0.46
158 0.43
159 0.46
160 0.48
161 0.46
162 0.54
163 0.56
164 0.61
165 0.58
166 0.63
167 0.63
168 0.58
169 0.56
170 0.49
171 0.43
172 0.36
173 0.32
174 0.24
175 0.17
176 0.19
177 0.19
178 0.18
179 0.15
180 0.13
181 0.12
182 0.13
183 0.12
184 0.11
185 0.13
186 0.11
187 0.15
188 0.16
189 0.16
190 0.18
191 0.17
192 0.16
193 0.13
194 0.14
195 0.11
196 0.11
197 0.12
198 0.12
199 0.15
200 0.16
201 0.19
202 0.21
203 0.25
204 0.29
205 0.37
206 0.4
207 0.43
208 0.49
209 0.55
210 0.56
211 0.53
212 0.53
213 0.51
214 0.48
215 0.44
216 0.36
217 0.31
218 0.29
219 0.34
220 0.38
221 0.42
222 0.43
223 0.46
224 0.52
225 0.55
226 0.61
227 0.64
228 0.65
229 0.65
230 0.68
231 0.74
232 0.74
233 0.72
234 0.67
235 0.58
236 0.49
237 0.45
238 0.41
239 0.33
240 0.34
241 0.37
242 0.36
243 0.39
244 0.44
245 0.46
246 0.5
247 0.59
248 0.61
249 0.57
250 0.59
251 0.57
252 0.51
253 0.45
254 0.4
255 0.33
256 0.25
257 0.29
258 0.3
259 0.38
260 0.47
261 0.57
262 0.63
263 0.7
264 0.75
265 0.78
266 0.83
267 0.83
268 0.78
269 0.73
270 0.69
271 0.64
272 0.57
273 0.51
274 0.42
275 0.38
276 0.37
277 0.34
278 0.3
279 0.3
280 0.32
281 0.34
282 0.42
283 0.46
284 0.5
285 0.56
286 0.63
287 0.68
288 0.73
289 0.76
290 0.78
291 0.79
292 0.81
293 0.84
294 0.85
295 0.84
296 0.8
297 0.74
298 0.65
299 0.58
300 0.57
301 0.51
302 0.5