Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P7C1H8

Protein Details
Accession A0A0P7C1H8    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
51-92NPDPNAPAPPKQRRKRRKAHEIPPKGPPKKRGPKPKPLSERVBasic
NLS Segment(s)
PositionSequence
58-101APPKQRRKRRKAHEIPPKGPPKKRGPKPKPLSERVYKAPKPIQR
Subcellular Location(s) nucl 19, cyto 5, mito 3
Family & Domain DBs
Amino Acid Sequences MPLPLVTPPSGTAPPVENTVSDIVVPLPQSAEPNVTTQDANIAAAAPPAQNPDPNAPAPPKQRRKRRKAHEIPPKGPPKKRGPKPKPLSERVYKAPKPIQRVERSYDPKKKEEVILYLMHHRVYDPNSNIKAPDGHRPPTFREAAAFFGIPSSTIGGWYKNKERLEAKANGTAPPRTKSKPKVPAAEPAVATPEPTAAPTPVPET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.23
3 0.22
4 0.17
5 0.19
6 0.2
7 0.18
8 0.15
9 0.13
10 0.11
11 0.11
12 0.12
13 0.09
14 0.09
15 0.1
16 0.11
17 0.12
18 0.14
19 0.14
20 0.15
21 0.17
22 0.17
23 0.16
24 0.15
25 0.16
26 0.14
27 0.13
28 0.11
29 0.1
30 0.08
31 0.09
32 0.09
33 0.07
34 0.07
35 0.1
36 0.11
37 0.12
38 0.14
39 0.18
40 0.21
41 0.22
42 0.25
43 0.24
44 0.3
45 0.38
46 0.46
47 0.53
48 0.59
49 0.69
50 0.77
51 0.84
52 0.88
53 0.9
54 0.9
55 0.9
56 0.91
57 0.91
58 0.9
59 0.83
60 0.82
61 0.82
62 0.77
63 0.71
64 0.69
65 0.69
66 0.69
67 0.75
68 0.77
69 0.75
70 0.79
71 0.83
72 0.85
73 0.83
74 0.79
75 0.77
76 0.72
77 0.68
78 0.64
79 0.65
80 0.56
81 0.52
82 0.52
83 0.48
84 0.48
85 0.5
86 0.52
87 0.48
88 0.51
89 0.5
90 0.52
91 0.56
92 0.58
93 0.6
94 0.56
95 0.52
96 0.51
97 0.48
98 0.43
99 0.38
100 0.32
101 0.28
102 0.26
103 0.24
104 0.26
105 0.25
106 0.21
107 0.19
108 0.16
109 0.15
110 0.16
111 0.21
112 0.2
113 0.26
114 0.28
115 0.29
116 0.29
117 0.27
118 0.28
119 0.23
120 0.3
121 0.28
122 0.31
123 0.34
124 0.36
125 0.4
126 0.42
127 0.41
128 0.32
129 0.3
130 0.26
131 0.26
132 0.25
133 0.21
134 0.14
135 0.13
136 0.13
137 0.11
138 0.1
139 0.08
140 0.06
141 0.08
142 0.09
143 0.13
144 0.17
145 0.23
146 0.29
147 0.34
148 0.35
149 0.4
150 0.42
151 0.44
152 0.47
153 0.48
154 0.45
155 0.45
156 0.46
157 0.44
158 0.44
159 0.44
160 0.4
161 0.38
162 0.4
163 0.39
164 0.47
165 0.53
166 0.6
167 0.65
168 0.69
169 0.73
170 0.7
171 0.75
172 0.71
173 0.67
174 0.57
175 0.48
176 0.44
177 0.35
178 0.33
179 0.23
180 0.19
181 0.14
182 0.15
183 0.16
184 0.12
185 0.13