FuNGI

Q6FNY8

Protein Details

Accession

Q6FNY8

Localization Confidence

Medium

Confidence Score

12.6

NoLS Segment(s)

Position	Sequence	Protein Nature
346-373	IFSKRGSKAANSKRKKKEQNPRYLQPSF	Hydrophilic

NLS Segment(s)

Position	Sequence
349-362	KRGSKAANSKRKKK

Subcellular Location(s)

nucl 17.5, cyto_nucl 13, cyto 7.5

Family & Domain DBs

InterPro	View protein in InterPro IPR041664 AAA_16 IPR020796 ORC5 IPR047088 ORC5_C IPR027417 P-loop_NTPase
Gene Ontology	GO:0031261 C:DNA replication preinitiation complex GO:0005664 C:nuclear origin of replication recognition complex GO:0005656 C:nuclear pre-replicative complex GO:0005524 F:ATP binding GO:0003688 F:DNA replication origin binding GO:0006270 P:DNA replication initiation GO:0006267 P:pre-replicative complex assembly involved in nuclear cell cycle DNA replication GO:0030466 P:silent mating-type cassette heterochromatin formation
KEGG	cgr:CAGL0J08008g -
Pfam	View protein in Pfam PF13191 AAA_16 PF14630 ORC5_C

Amino Acid Sequences

MSKSNLVVLFRDYQLELLDSLIDVDSTLTTPNLILQGYSGTGKTLTLRKVFELKPDIINVWLDPIEVVSWKPLFQAIARSTQQRLMQKYPGLQDKEYDPMAVEEPSFLVKYLIKLFSHYKELPEKIPLYIVYDGFDSLQDLDSQILYKLLKLHELLPNDNAIVMKSIYTVRDLNFVNRYSSNAIPMVVFPRYNLDEIIKILILTRAQELVGSSFLVMQLELLDECEYTNESLEKVAVNFIQLIVQAFHSYTGNDIYALNDLIDFKWPLYLKNLDKNNILDPLALYRANVRLFITTDDSLKNDFNDTYEDYSDTAMTQTYELSNISKYLLIAAYFCSYIETKFDIGIFSKRGSKAANSKRKKKEQNPRYLQPSFFYIERLLAIFQSIYPLEIEVPKGSLAALKVDDLMKSNVEVFQNLAELFSLKLITCSSSKNLDVLGNKIKWRVNIPWEIISEIASSVSFDISEYFSGVHD

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.2
2	0.2
3	0.16
4	0.12
5	0.12
6	0.09
7	0.1
8	0.09
9	0.07
10	0.06
11	0.06
12	0.06
13	0.07
14	0.08
15	0.07
16	0.07
17	0.07
18	0.09
19	0.11
20	0.1
21	0.1
22	0.09
23	0.11
24	0.12
25	0.13
26	0.11
27	0.1
28	0.1
29	0.11
30	0.15
31	0.2
32	0.24
33	0.28
34	0.3
35	0.33
36	0.41
37	0.42
38	0.46
39	0.46
40	0.43
41	0.42
42	0.42
43	0.39
44	0.32
45	0.32
46	0.23
47	0.2
48	0.17
49	0.14
50	0.11
51	0.11
52	0.1
53	0.1
54	0.1
55	0.11
56	0.12
57	0.12
58	0.12
59	0.13
60	0.14
61	0.14
62	0.23
63	0.21
64	0.28
65	0.31
66	0.33
67	0.34
68	0.38
69	0.43
70	0.41
71	0.45
72	0.42
73	0.45
74	0.46
75	0.49
76	0.5
77	0.53
78	0.5
79	0.44
80	0.41
81	0.38
82	0.39
83	0.34
84	0.28
85	0.2
86	0.17
87	0.18
88	0.16
89	0.14
90	0.1
91	0.1
92	0.11
93	0.11
94	0.09
95	0.09
96	0.1
97	0.12
98	0.17
99	0.2
100	0.19
101	0.22
102	0.27
103	0.28
104	0.35
105	0.33
106	0.33
107	0.36
108	0.39
109	0.38
110	0.38
111	0.36
112	0.29
113	0.3
114	0.26
115	0.23
116	0.22
117	0.2
118	0.15
119	0.15
120	0.14
121	0.13
122	0.12
123	0.09
124	0.07
125	0.08
126	0.07
127	0.07
128	0.07
129	0.07
130	0.07
131	0.07
132	0.08
133	0.08
134	0.09
135	0.12
136	0.12
137	0.14
138	0.15
139	0.19
140	0.21
141	0.24
142	0.25
143	0.22
144	0.22
145	0.2
146	0.19
147	0.15
148	0.11
149	0.09
150	0.08
151	0.07
152	0.07
153	0.09
154	0.09
155	0.11
156	0.12
157	0.12
158	0.17
159	0.17
160	0.2
161	0.23
162	0.23
163	0.23
164	0.22
165	0.24
166	0.22
167	0.22
168	0.21
169	0.17
170	0.16
171	0.14
172	0.14
173	0.14
174	0.12
175	0.11
176	0.09
177	0.13
178	0.14
179	0.14
180	0.14
181	0.12
182	0.12
183	0.13
184	0.14
185	0.1
186	0.08
187	0.08
188	0.09
189	0.08
190	0.08
191	0.08
192	0.07
193	0.07
194	0.07
195	0.07
196	0.07
197	0.07
198	0.06
199	0.06
200	0.05
201	0.06
202	0.05
203	0.05
204	0.04
205	0.03
206	0.04
207	0.04
208	0.04
209	0.04
210	0.04
211	0.04
212	0.05
213	0.05
214	0.05
215	0.05
216	0.05
217	0.05
218	0.05
219	0.06
220	0.06
221	0.05
222	0.06
223	0.06
224	0.06
225	0.06
226	0.05
227	0.06
228	0.05
229	0.06
230	0.05
231	0.06
232	0.06
233	0.05
234	0.06
235	0.06
236	0.06
237	0.06
238	0.06
239	0.06
240	0.06
241	0.06
242	0.06
243	0.07
244	0.07
245	0.06
246	0.06
247	0.06
248	0.06
249	0.08
250	0.07
251	0.06
252	0.1
253	0.1
254	0.11
255	0.14
256	0.21
257	0.22
258	0.29
259	0.33
260	0.32
261	0.34
262	0.35
263	0.33
264	0.29
265	0.26
266	0.19
267	0.15
268	0.14
269	0.14
270	0.13
271	0.11
272	0.1
273	0.13
274	0.14
275	0.14
276	0.13
277	0.12
278	0.13
279	0.15
280	0.17
281	0.14
282	0.16
283	0.16
284	0.16
285	0.17
286	0.16
287	0.15
288	0.13
289	0.12
290	0.11
291	0.14
292	0.15
293	0.15
294	0.15
295	0.15
296	0.14
297	0.15
298	0.14
299	0.11
300	0.09
301	0.07
302	0.07
303	0.06
304	0.06
305	0.06
306	0.07
307	0.07
308	0.08
309	0.08
310	0.08
311	0.09
312	0.09
313	0.08
314	0.09
315	0.09
316	0.09
317	0.08
318	0.09
319	0.1
320	0.09
321	0.09
322	0.1
323	0.09
324	0.1
325	0.12
326	0.12
327	0.12
328	0.12
329	0.13
330	0.12
331	0.13
332	0.17
333	0.16
334	0.16
335	0.22
336	0.22
337	0.24
338	0.24
339	0.28
340	0.35
341	0.44
342	0.53
343	0.57
344	0.67
345	0.75
346	0.84
347	0.89
348	0.89
349	0.9
350	0.89
351	0.91
352	0.9
353	0.88
354	0.86
355	0.8
356	0.71
357	0.61
358	0.55
359	0.46
360	0.37
361	0.31
362	0.23
363	0.19
364	0.19
365	0.18
366	0.14
367	0.11
368	0.11
369	0.09
370	0.08
371	0.1
372	0.09
373	0.09
374	0.09
375	0.09
376	0.1
377	0.11
378	0.13
379	0.11
380	0.12
381	0.11
382	0.11
383	0.1
384	0.11
385	0.11
386	0.12
387	0.12
388	0.11
389	0.13
390	0.14
391	0.15
392	0.15
393	0.17
394	0.14
395	0.14
396	0.15
397	0.17
398	0.17
399	0.17
400	0.15
401	0.14
402	0.15
403	0.14
404	0.13
405	0.1
406	0.1
407	0.09
408	0.09
409	0.09
410	0.07
411	0.09
412	0.09
413	0.12
414	0.13
415	0.16
416	0.19
417	0.23
418	0.24
419	0.24
420	0.26
421	0.28
422	0.29
423	0.32
424	0.37
425	0.36
426	0.38
427	0.42
428	0.43
429	0.41
430	0.45
431	0.46
432	0.46
433	0.5
434	0.52
435	0.51
436	0.5
437	0.47
438	0.42
439	0.35
440	0.27
441	0.19
442	0.16
443	0.1
444	0.09
445	0.09
446	0.09
447	0.07
448	0.07
449	0.08
450	0.1
451	0.1
452	0.1

Q6FNY8

3D AlphaFold-predicted Structure Viewer