Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0P7B2S4

Protein Details
Accession A0A0P7B2S4    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
82-108PLKDDDTPKPTPRRRGRPPKAKPVANGBasic
203-230EAATPSKTPRRKGRPRKVRSPTPPRDLPBasic
NLS Segment(s)
PositionSequence
90-104KPTPRRRGRPPKAKP
209-223KTPRRKGRPRKVRSP
Subcellular Location(s) nucl 16, cyto_nucl 11.5, cyto 5, mito 2, plas 1, pero 1, cysk 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR007220  ORC2  
Gene Ontology GO:0005664  C:nuclear origin of replication recognition complex  
GO:0003688  F:DNA replication origin binding  
GO:0006260  P:DNA replication  
Pfam View protein in Pfam  
PF04084  ORC2  
Amino Acid Sequences MPPRKKAQLDVPHQADEPRLLRKRSHQELEAIPESDLETTPTKRQRSSRYSPTTDDTESDSQTQSLTADVVESIPIAIAVSPLKDDDTPKPTPRRRGRPPKAKPVANGDTPTPKASRTANFATPTKKTTSVNGLTPLRQAADQSARRKSARAYIEHVVGDELTDEEDNGNIPRQIIDSSEDEEDEDLGEGEGTATAETSAVDEAATPSKTPRRKGRPRKVRSPTPPRDLPLHELYFAHNKPGRSKTSNNTFGSLVLLTHDEYFTIVKDTPDRHAADIEYLESLHAESFPQWTFEISQGFGVCLYGFGSKRKLLHKLAAHLHSRRRADKGDKIVMVNGYAHTTTMREILSNVGNAIDPSQRIPLAQPPIMVQSIISQLAITDMILTLVINSIDATPLRKPGYHVALAQLAAHPQVQIVCSADTPDFSLLWDIGVRSSFNFVFHDCTTFAPYAVELDVVDEVHELLGRNAHRVNGREGVAFVLRSLPENAKKLFSLLVMEVILAMEEEGAGTGDEPTGVEYRMLYNKAVEEFICSSEMAFRTLLKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.47
3 0.43
4 0.38
5 0.38
6 0.41
7 0.41
8 0.45
9 0.54
10 0.62
11 0.66
12 0.69
13 0.62
14 0.62
15 0.64
16 0.67
17 0.61
18 0.52
19 0.42
20 0.35
21 0.32
22 0.26
23 0.21
24 0.16
25 0.16
26 0.18
27 0.27
28 0.34
29 0.38
30 0.44
31 0.52
32 0.59
33 0.65
34 0.71
35 0.73
36 0.75
37 0.76
38 0.74
39 0.71
40 0.66
41 0.58
42 0.5
43 0.46
44 0.39
45 0.36
46 0.34
47 0.29
48 0.24
49 0.22
50 0.21
51 0.15
52 0.12
53 0.1
54 0.07
55 0.07
56 0.07
57 0.07
58 0.06
59 0.06
60 0.06
61 0.05
62 0.05
63 0.05
64 0.04
65 0.05
66 0.06
67 0.06
68 0.07
69 0.08
70 0.09
71 0.11
72 0.15
73 0.2
74 0.26
75 0.32
76 0.39
77 0.49
78 0.55
79 0.64
80 0.71
81 0.75
82 0.8
83 0.86
84 0.89
85 0.9
86 0.92
87 0.93
88 0.92
89 0.87
90 0.8
91 0.78
92 0.73
93 0.67
94 0.59
95 0.51
96 0.48
97 0.45
98 0.43
99 0.34
100 0.28
101 0.27
102 0.29
103 0.29
104 0.29
105 0.33
106 0.36
107 0.39
108 0.43
109 0.44
110 0.42
111 0.42
112 0.39
113 0.38
114 0.33
115 0.33
116 0.38
117 0.37
118 0.37
119 0.41
120 0.4
121 0.37
122 0.37
123 0.34
124 0.26
125 0.22
126 0.19
127 0.17
128 0.24
129 0.3
130 0.35
131 0.4
132 0.44
133 0.44
134 0.46
135 0.43
136 0.42
137 0.41
138 0.39
139 0.39
140 0.37
141 0.4
142 0.38
143 0.35
144 0.27
145 0.21
146 0.17
147 0.11
148 0.08
149 0.06
150 0.05
151 0.05
152 0.05
153 0.05
154 0.06
155 0.06
156 0.08
157 0.07
158 0.08
159 0.08
160 0.09
161 0.09
162 0.1
163 0.12
164 0.12
165 0.14
166 0.14
167 0.14
168 0.13
169 0.13
170 0.12
171 0.09
172 0.07
173 0.05
174 0.04
175 0.04
176 0.04
177 0.04
178 0.04
179 0.04
180 0.03
181 0.03
182 0.03
183 0.04
184 0.04
185 0.04
186 0.04
187 0.04
188 0.04
189 0.04
190 0.05
191 0.08
192 0.08
193 0.08
194 0.11
195 0.18
196 0.23
197 0.29
198 0.39
199 0.47
200 0.58
201 0.7
202 0.78
203 0.82
204 0.86
205 0.91
206 0.9
207 0.89
208 0.88
209 0.88
210 0.85
211 0.82
212 0.77
213 0.68
214 0.64
215 0.56
216 0.51
217 0.46
218 0.38
219 0.31
220 0.28
221 0.27
222 0.3
223 0.27
224 0.28
225 0.24
226 0.24
227 0.29
228 0.34
229 0.38
230 0.36
231 0.41
232 0.42
233 0.49
234 0.57
235 0.52
236 0.49
237 0.43
238 0.38
239 0.35
240 0.27
241 0.17
242 0.09
243 0.09
244 0.07
245 0.07
246 0.07
247 0.05
248 0.06
249 0.06
250 0.06
251 0.07
252 0.07
253 0.07
254 0.1
255 0.12
256 0.13
257 0.18
258 0.19
259 0.17
260 0.18
261 0.17
262 0.15
263 0.14
264 0.13
265 0.08
266 0.07
267 0.06
268 0.05
269 0.05
270 0.04
271 0.04
272 0.04
273 0.04
274 0.06
275 0.07
276 0.08
277 0.08
278 0.09
279 0.09
280 0.11
281 0.12
282 0.1
283 0.1
284 0.09
285 0.09
286 0.08
287 0.08
288 0.06
289 0.05
290 0.05
291 0.07
292 0.08
293 0.1
294 0.13
295 0.15
296 0.19
297 0.22
298 0.28
299 0.28
300 0.34
301 0.36
302 0.39
303 0.43
304 0.45
305 0.47
306 0.45
307 0.48
308 0.48
309 0.49
310 0.45
311 0.43
312 0.43
313 0.45
314 0.47
315 0.49
316 0.49
317 0.46
318 0.44
319 0.42
320 0.36
321 0.3
322 0.24
323 0.16
324 0.11
325 0.1
326 0.09
327 0.08
328 0.08
329 0.08
330 0.09
331 0.09
332 0.08
333 0.08
334 0.11
335 0.12
336 0.11
337 0.11
338 0.09
339 0.09
340 0.09
341 0.1
342 0.09
343 0.08
344 0.09
345 0.11
346 0.1
347 0.1
348 0.12
349 0.16
350 0.2
351 0.21
352 0.2
353 0.19
354 0.22
355 0.22
356 0.2
357 0.14
358 0.11
359 0.12
360 0.12
361 0.11
362 0.08
363 0.07
364 0.08
365 0.08
366 0.06
367 0.04
368 0.04
369 0.04
370 0.04
371 0.04
372 0.03
373 0.04
374 0.04
375 0.04
376 0.04
377 0.04
378 0.06
379 0.06
380 0.08
381 0.09
382 0.14
383 0.15
384 0.16
385 0.19
386 0.25
387 0.3
388 0.31
389 0.3
390 0.28
391 0.29
392 0.28
393 0.26
394 0.2
395 0.14
396 0.12
397 0.12
398 0.09
399 0.07
400 0.08
401 0.08
402 0.08
403 0.09
404 0.09
405 0.09
406 0.11
407 0.11
408 0.1
409 0.12
410 0.12
411 0.1
412 0.1
413 0.11
414 0.09
415 0.09
416 0.1
417 0.08
418 0.08
419 0.09
420 0.09
421 0.09
422 0.13
423 0.13
424 0.13
425 0.15
426 0.15
427 0.19
428 0.19
429 0.21
430 0.18
431 0.19
432 0.22
433 0.21
434 0.2
435 0.15
436 0.14
437 0.13
438 0.13
439 0.11
440 0.07
441 0.08
442 0.08
443 0.08
444 0.08
445 0.06
446 0.06
447 0.06
448 0.07
449 0.07
450 0.07
451 0.12
452 0.12
453 0.16
454 0.17
455 0.21
456 0.24
457 0.27
458 0.31
459 0.32
460 0.33
461 0.31
462 0.3
463 0.29
464 0.26
465 0.23
466 0.18
467 0.17
468 0.15
469 0.17
470 0.2
471 0.24
472 0.28
473 0.33
474 0.35
475 0.34
476 0.34
477 0.33
478 0.31
479 0.25
480 0.22
481 0.18
482 0.18
483 0.15
484 0.15
485 0.13
486 0.11
487 0.1
488 0.07
489 0.06
490 0.03
491 0.03
492 0.03
493 0.03
494 0.04
495 0.04
496 0.04
497 0.05
498 0.05
499 0.05
500 0.05
501 0.08
502 0.09
503 0.1
504 0.1
505 0.1
506 0.15
507 0.21
508 0.23
509 0.21
510 0.22
511 0.25
512 0.26
513 0.27
514 0.23
515 0.22
516 0.22
517 0.23
518 0.22
519 0.19
520 0.17
521 0.22
522 0.22
523 0.19
524 0.18