Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0P7B3G3

Protein Details
Accession A0A0P7B3G3    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-33MAPRSRNPPPRRPSRSKHNSNPNPKLKQKPSSSHydrophilic
NLS Segment(s)
PositionSequence
5-27SRNPPPRRPSRSKHNSNPNPKLK
Subcellular Location(s) nucl 12, mito 10, cyto_nucl 10, cyto 4
Family & Domain DBs
Amino Acid Sequences MAPRSRNPPPRRPSRSKHNSNPNPKLKQKPSSSYLVPALSSLRTLPPISHASATSPASLPASTISQQAPSAKHASWNMSVDFNNRDSPVEISDTCEVWHSVPGAHPLRLNPPFTTVDKGLTPVSRDEPFHPQQRAQHIQVLDHYWGGRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.87
4 0.88
5 0.88
6 0.89
7 0.9
8 0.92
9 0.91
10 0.89
11 0.86
12 0.86
13 0.83
14 0.82
15 0.79
16 0.75
17 0.7
18 0.67
19 0.61
20 0.54
21 0.5
22 0.41
23 0.33
24 0.27
25 0.24
26 0.17
27 0.16
28 0.13
29 0.1
30 0.11
31 0.12
32 0.11
33 0.14
34 0.17
35 0.18
36 0.18
37 0.17
38 0.17
39 0.2
40 0.21
41 0.17
42 0.15
43 0.14
44 0.13
45 0.13
46 0.11
47 0.08
48 0.1
49 0.09
50 0.11
51 0.1
52 0.1
53 0.12
54 0.14
55 0.14
56 0.14
57 0.16
58 0.14
59 0.17
60 0.18
61 0.19
62 0.19
63 0.2
64 0.18
65 0.17
66 0.18
67 0.17
68 0.17
69 0.16
70 0.16
71 0.14
72 0.14
73 0.14
74 0.14
75 0.14
76 0.14
77 0.13
78 0.14
79 0.15
80 0.14
81 0.14
82 0.14
83 0.13
84 0.1
85 0.12
86 0.09
87 0.09
88 0.1
89 0.17
90 0.19
91 0.19
92 0.2
93 0.2
94 0.28
95 0.31
96 0.32
97 0.25
98 0.27
99 0.29
100 0.3
101 0.34
102 0.27
103 0.26
104 0.24
105 0.25
106 0.24
107 0.22
108 0.22
109 0.2
110 0.23
111 0.23
112 0.25
113 0.27
114 0.33
115 0.38
116 0.44
117 0.45
118 0.45
119 0.48
120 0.56
121 0.59
122 0.54
123 0.54
124 0.47
125 0.45
126 0.45
127 0.43
128 0.34
129 0.29