Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6FNR7

Protein Details
Accession Q6FNR7   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
8-38AKPLASKKLNKKVLKTVKKASRAKNVKRGVKHydrophilic
NLS Segment(s)
PositionSequence
12-48ASKKLNKKVLKTVKKASRAKNVKRGVKEVVKALRKGE
Subcellular Location(s) mito 14.5, mito_nucl 10.333, cyto 7.5, cyto_nucl 6.833, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002415  H/ACA_rnp_Nhp2-like  
IPR029064  L30e-like  
IPR004038  Ribosomal_L7Ae/L30e/S12e/Gad45  
IPR018492  Ribosomal_L7Ae/L8/Nhp2  
IPR004037  Ribosomal_L7Ae_CS  
Gene Ontology GO:0005730  C:nucleolus  
GO:1990904  C:ribonucleoprotein complex  
GO:0003723  F:RNA binding  
GO:0006364  P:rRNA processing  
KEGG cgr:CAGL0J09614g  -  
Pfam View protein in Pfam  
PF01248  Ribosomal_L7Ae  
PROSITE View protein in PROSITE  
PS01082  RIBOSOMAL_L7AE  
Amino Acid Sequences MPAVLPFAKPLASKKLNKKVLKTVKKASRAKNVKRGVKEVVKALRKGEKGLVVIAGDISPADVISHIPVLCEDHGVPYLFVPSKQDLGSASATKRPTSVIFIVPGSNKKDKSKEEEYKESYNEVVKEVKAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.61
3 0.69
4 0.73
5 0.75
6 0.76
7 0.78
8 0.8
9 0.77
10 0.77
11 0.76
12 0.8
13 0.83
14 0.8
15 0.8
16 0.8
17 0.81
18 0.81
19 0.82
20 0.79
21 0.75
22 0.71
23 0.68
24 0.64
25 0.57
26 0.54
27 0.53
28 0.5
29 0.47
30 0.46
31 0.45
32 0.39
33 0.39
34 0.34
35 0.29
36 0.25
37 0.24
38 0.21
39 0.14
40 0.13
41 0.12
42 0.09
43 0.05
44 0.04
45 0.04
46 0.03
47 0.03
48 0.03
49 0.03
50 0.03
51 0.03
52 0.05
53 0.05
54 0.05
55 0.05
56 0.07
57 0.06
58 0.07
59 0.07
60 0.07
61 0.08
62 0.09
63 0.09
64 0.07
65 0.1
66 0.09
67 0.1
68 0.12
69 0.11
70 0.13
71 0.13
72 0.14
73 0.12
74 0.14
75 0.17
76 0.17
77 0.17
78 0.19
79 0.21
80 0.2
81 0.2
82 0.19
83 0.18
84 0.21
85 0.22
86 0.2
87 0.2
88 0.21
89 0.23
90 0.24
91 0.27
92 0.28
93 0.32
94 0.33
95 0.37
96 0.44
97 0.47
98 0.53
99 0.59
100 0.63
101 0.65
102 0.71
103 0.71
104 0.69
105 0.66
106 0.59
107 0.51
108 0.46
109 0.38
110 0.31
111 0.28