Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0P7BCP9

Protein Details
Accession A0A0P7BCP9    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
242-267HPPDIRGKDRRGSKARKNRGLFWRGLBasic
NLS Segment(s)
PositionSequence
247-261RGKDRRGSKARKNRG
Subcellular Location(s) nucl 18.5, cyto_nucl 14.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045030  LYSM1-4  
Pfam View protein in Pfam  
PF14555  UBA_4  
Amino Acid Sequences MDSCCTCTTILSSTPPYSKEAESLPQDRRLKCCARIICGKCIHDNRRFADYCPYCQISSIPSPLPQRLRDPPTYTSVPSSSSRTTELSDTPPPYTPVSETIRATGAVDDEKAALEAEDRKTVAQDILHFLDHNHDSVTSLSLRYGVPTAVLRQANNVTSDHLLLGRRTILIPGEYYKGGVSLSPRPIEGEDEELRKGKIRRFMTCCKVSDYDIAVLYLEQSGYDIEAAVDAYMEDELWETEHPPDIRGKDRRGSKARKNRGLFWRGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.34
4 0.33
5 0.31
6 0.29
7 0.28
8 0.3
9 0.34
10 0.39
11 0.41
12 0.47
13 0.53
14 0.53
15 0.54
16 0.55
17 0.55
18 0.54
19 0.58
20 0.54
21 0.53
22 0.61
23 0.6
24 0.61
25 0.62
26 0.59
27 0.59
28 0.64
29 0.65
30 0.63
31 0.65
32 0.6
33 0.61
34 0.6
35 0.53
36 0.54
37 0.49
38 0.46
39 0.46
40 0.45
41 0.36
42 0.36
43 0.35
44 0.28
45 0.29
46 0.28
47 0.23
48 0.25
49 0.28
50 0.33
51 0.37
52 0.36
53 0.38
54 0.43
55 0.47
56 0.48
57 0.5
58 0.47
59 0.48
60 0.48
61 0.43
62 0.37
63 0.32
64 0.3
65 0.27
66 0.29
67 0.24
68 0.23
69 0.24
70 0.22
71 0.23
72 0.22
73 0.22
74 0.22
75 0.25
76 0.25
77 0.25
78 0.24
79 0.25
80 0.24
81 0.22
82 0.19
83 0.2
84 0.22
85 0.24
86 0.23
87 0.22
88 0.22
89 0.21
90 0.2
91 0.15
92 0.11
93 0.08
94 0.08
95 0.07
96 0.07
97 0.06
98 0.06
99 0.06
100 0.04
101 0.05
102 0.09
103 0.1
104 0.11
105 0.11
106 0.11
107 0.11
108 0.12
109 0.12
110 0.09
111 0.09
112 0.11
113 0.12
114 0.12
115 0.12
116 0.11
117 0.14
118 0.14
119 0.13
120 0.1
121 0.08
122 0.09
123 0.09
124 0.11
125 0.07
126 0.07
127 0.07
128 0.08
129 0.08
130 0.08
131 0.08
132 0.06
133 0.07
134 0.07
135 0.09
136 0.13
137 0.14
138 0.13
139 0.15
140 0.17
141 0.17
142 0.18
143 0.17
144 0.13
145 0.13
146 0.13
147 0.11
148 0.11
149 0.11
150 0.1
151 0.1
152 0.09
153 0.09
154 0.09
155 0.09
156 0.09
157 0.08
158 0.09
159 0.1
160 0.12
161 0.11
162 0.12
163 0.11
164 0.1
165 0.09
166 0.09
167 0.11
168 0.15
169 0.18
170 0.19
171 0.19
172 0.2
173 0.2
174 0.22
175 0.2
176 0.2
177 0.19
178 0.21
179 0.22
180 0.22
181 0.22
182 0.25
183 0.27
184 0.26
185 0.32
186 0.35
187 0.42
188 0.49
189 0.57
190 0.61
191 0.64
192 0.61
193 0.58
194 0.55
195 0.48
196 0.45
197 0.39
198 0.32
199 0.26
200 0.24
201 0.19
202 0.16
203 0.15
204 0.11
205 0.08
206 0.05
207 0.05
208 0.05
209 0.05
210 0.06
211 0.05
212 0.04
213 0.05
214 0.05
215 0.05
216 0.04
217 0.04
218 0.04
219 0.04
220 0.04
221 0.04
222 0.04
223 0.05
224 0.06
225 0.07
226 0.08
227 0.09
228 0.16
229 0.16
230 0.17
231 0.23
232 0.27
233 0.36
234 0.42
235 0.47
236 0.49
237 0.58
238 0.66
239 0.71
240 0.76
241 0.78
242 0.81
243 0.87
244 0.89
245 0.85
246 0.85
247 0.85