Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0N8H602

Protein Details
Accession A0A0N8H602    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
98-121SVQPSKTRIAKKRVDKRNVKKAGIHydrophilic
NLS Segment(s)
PositionSequence
104-141TRIAKKRVDKRNVKKAGIVFRKYSDRVAANKKKAASSK
Subcellular Location(s) mito 25
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSARASSRKANNQRLAAKVFGPVEAARAERLHAKLLELAKQPKPESKATLDTQEGAAEADKEVQAGEETSKLPLRPTLHPPNVANNMPPQVMDVDSVQPSKTRIAKKRVDKRNVKKAGIVFRKYSDRVAANKKKAASSKAASSKAATPSAAVAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.78
3 0.74
4 0.67
5 0.58
6 0.49
7 0.43
8 0.36
9 0.27
10 0.24
11 0.19
12 0.17
13 0.16
14 0.17
15 0.14
16 0.13
17 0.14
18 0.17
19 0.18
20 0.2
21 0.19
22 0.2
23 0.22
24 0.24
25 0.29
26 0.29
27 0.34
28 0.33
29 0.38
30 0.39
31 0.39
32 0.42
33 0.39
34 0.38
35 0.37
36 0.39
37 0.36
38 0.39
39 0.34
40 0.31
41 0.28
42 0.23
43 0.19
44 0.13
45 0.11
46 0.07
47 0.06
48 0.06
49 0.06
50 0.06
51 0.05
52 0.05
53 0.05
54 0.05
55 0.06
56 0.06
57 0.06
58 0.08
59 0.09
60 0.09
61 0.09
62 0.13
63 0.15
64 0.18
65 0.25
66 0.33
67 0.35
68 0.38
69 0.39
70 0.41
71 0.42
72 0.39
73 0.32
74 0.25
75 0.24
76 0.2
77 0.19
78 0.14
79 0.1
80 0.1
81 0.1
82 0.09
83 0.09
84 0.11
85 0.11
86 0.11
87 0.11
88 0.12
89 0.16
90 0.21
91 0.28
92 0.35
93 0.43
94 0.52
95 0.61
96 0.71
97 0.76
98 0.8
99 0.83
100 0.85
101 0.87
102 0.87
103 0.78
104 0.73
105 0.68
106 0.69
107 0.67
108 0.61
109 0.53
110 0.49
111 0.54
112 0.5
113 0.47
114 0.42
115 0.37
116 0.41
117 0.49
118 0.54
119 0.55
120 0.58
121 0.58
122 0.58
123 0.59
124 0.56
125 0.53
126 0.48
127 0.51
128 0.55
129 0.56
130 0.51
131 0.48
132 0.49
133 0.46
134 0.44
135 0.34
136 0.26