Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0P7BXC2

Protein Details
Accession A0A0P7BXC2    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
503-522VLSQRPDGPNRGRRRRGPPABasic
NLS Segment(s)
PositionSequence
512-522NRGRRRRGPPA
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Amino Acid Sequences MTTAAQHQQSDHSHGFVIADTYDPDEVVPRDSPLMTPLRPRLAPTPSPPPDIPPAQVSLSPASLDDRDKSNRHKVRPNSGDAILVAYLDNGRDPEIARVAGRQLLAGEEDSPDHESSPDGPTDEVVLTVPSLQHLAADALQVAAFAAGPNPHPNLSSISALGLKASPDISVSTRHLSLHDDNPASPFSYPGADNKPDARSPPVAILTPASGELPPLQMDSPRSDSNGPILPSIRLTLGDIDRLPPEPIAPADKELSSRHAHGPGFPASPPLGIPRFPPIAISHVSPPASPNEGFTRTLPSPRSLPASSPYYYGPNTINPRHNAEYSSSSATGETPSTDHSASTPATSTSVADRMSIDGITNPQIGAYVCTFGGCTAPAFQTQYLLNSHANVHSSARPHYCPVRGCPRSEGGKGFKRKNEMIRHGLVHDSPGYVCPFCPDREHKYPRPDNLQRYDGDRPISKPLLSSCSDQCFEACKKLTRWTDRHVRVHHVDKDKDDPLLRDVLSQRPDGPNRGRRRRGPPA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.27
3 0.21
4 0.19
5 0.12
6 0.11
7 0.11
8 0.12
9 0.12
10 0.11
11 0.11
12 0.14
13 0.14
14 0.17
15 0.17
16 0.16
17 0.18
18 0.19
19 0.19
20 0.2
21 0.25
22 0.24
23 0.31
24 0.35
25 0.4
26 0.4
27 0.44
28 0.45
29 0.47
30 0.51
31 0.49
32 0.54
33 0.52
34 0.57
35 0.54
36 0.52
37 0.51
38 0.48
39 0.44
40 0.36
41 0.35
42 0.3
43 0.31
44 0.29
45 0.24
46 0.22
47 0.2
48 0.17
49 0.17
50 0.18
51 0.19
52 0.19
53 0.23
54 0.28
55 0.34
56 0.41
57 0.49
58 0.55
59 0.6
60 0.68
61 0.7
62 0.75
63 0.77
64 0.76
65 0.7
66 0.63
67 0.57
68 0.47
69 0.41
70 0.29
71 0.22
72 0.15
73 0.1
74 0.09
75 0.08
76 0.08
77 0.07
78 0.08
79 0.09
80 0.1
81 0.12
82 0.14
83 0.15
84 0.15
85 0.16
86 0.16
87 0.18
88 0.17
89 0.14
90 0.12
91 0.12
92 0.13
93 0.12
94 0.11
95 0.09
96 0.09
97 0.1
98 0.13
99 0.12
100 0.11
101 0.11
102 0.11
103 0.13
104 0.15
105 0.14
106 0.12
107 0.12
108 0.12
109 0.14
110 0.13
111 0.11
112 0.08
113 0.08
114 0.07
115 0.08
116 0.07
117 0.06
118 0.07
119 0.06
120 0.06
121 0.06
122 0.07
123 0.07
124 0.07
125 0.07
126 0.06
127 0.06
128 0.06
129 0.05
130 0.04
131 0.04
132 0.03
133 0.04
134 0.05
135 0.07
136 0.09
137 0.11
138 0.11
139 0.12
140 0.13
141 0.16
142 0.18
143 0.18
144 0.16
145 0.15
146 0.16
147 0.15
148 0.15
149 0.11
150 0.09
151 0.08
152 0.08
153 0.07
154 0.06
155 0.08
156 0.09
157 0.12
158 0.14
159 0.16
160 0.16
161 0.17
162 0.17
163 0.2
164 0.23
165 0.23
166 0.27
167 0.25
168 0.24
169 0.26
170 0.25
171 0.22
172 0.18
173 0.14
174 0.1
175 0.11
176 0.11
177 0.13
178 0.18
179 0.19
180 0.2
181 0.23
182 0.25
183 0.24
184 0.25
185 0.25
186 0.22
187 0.21
188 0.23
189 0.21
190 0.19
191 0.18
192 0.17
193 0.13
194 0.12
195 0.11
196 0.08
197 0.07
198 0.07
199 0.07
200 0.07
201 0.07
202 0.07
203 0.07
204 0.08
205 0.1
206 0.13
207 0.16
208 0.16
209 0.18
210 0.18
211 0.18
212 0.2
213 0.22
214 0.19
215 0.16
216 0.16
217 0.15
218 0.15
219 0.15
220 0.12
221 0.08
222 0.08
223 0.1
224 0.1
225 0.11
226 0.11
227 0.11
228 0.12
229 0.12
230 0.12
231 0.09
232 0.09
233 0.08
234 0.09
235 0.1
236 0.1
237 0.1
238 0.11
239 0.11
240 0.13
241 0.13
242 0.16
243 0.15
244 0.17
245 0.17
246 0.21
247 0.2
248 0.2
249 0.23
250 0.21
251 0.2
252 0.18
253 0.18
254 0.13
255 0.14
256 0.13
257 0.12
258 0.11
259 0.1
260 0.11
261 0.14
262 0.15
263 0.15
264 0.16
265 0.13
266 0.15
267 0.16
268 0.16
269 0.14
270 0.16
271 0.16
272 0.15
273 0.15
274 0.14
275 0.16
276 0.14
277 0.15
278 0.16
279 0.18
280 0.2
281 0.19
282 0.23
283 0.21
284 0.25
285 0.25
286 0.22
287 0.22
288 0.22
289 0.27
290 0.22
291 0.22
292 0.23
293 0.25
294 0.24
295 0.24
296 0.23
297 0.21
298 0.21
299 0.21
300 0.18
301 0.2
302 0.25
303 0.29
304 0.34
305 0.33
306 0.39
307 0.39
308 0.39
309 0.34
310 0.31
311 0.3
312 0.27
313 0.27
314 0.22
315 0.19
316 0.19
317 0.18
318 0.16
319 0.12
320 0.1
321 0.07
322 0.09
323 0.11
324 0.11
325 0.11
326 0.1
327 0.12
328 0.12
329 0.12
330 0.11
331 0.09
332 0.1
333 0.11
334 0.11
335 0.1
336 0.12
337 0.12
338 0.12
339 0.12
340 0.12
341 0.12
342 0.11
343 0.1
344 0.08
345 0.09
346 0.11
347 0.11
348 0.09
349 0.08
350 0.09
351 0.09
352 0.1
353 0.09
354 0.09
355 0.08
356 0.08
357 0.09
358 0.08
359 0.08
360 0.07
361 0.07
362 0.07
363 0.09
364 0.1
365 0.12
366 0.12
367 0.14
368 0.14
369 0.15
370 0.15
371 0.17
372 0.16
373 0.15
374 0.17
375 0.16
376 0.17
377 0.16
378 0.17
379 0.17
380 0.19
381 0.23
382 0.26
383 0.26
384 0.29
385 0.33
386 0.36
387 0.37
388 0.42
389 0.48
390 0.47
391 0.48
392 0.48
393 0.49
394 0.5
395 0.49
396 0.49
397 0.46
398 0.52
399 0.58
400 0.6
401 0.59
402 0.6
403 0.63
404 0.66
405 0.68
406 0.67
407 0.65
408 0.63
409 0.6
410 0.54
411 0.51
412 0.41
413 0.34
414 0.26
415 0.21
416 0.16
417 0.16
418 0.17
419 0.15
420 0.15
421 0.16
422 0.18
423 0.19
424 0.26
425 0.3
426 0.37
427 0.47
428 0.56
429 0.6
430 0.68
431 0.75
432 0.75
433 0.79
434 0.79
435 0.78
436 0.76
437 0.73
438 0.64
439 0.62
440 0.61
441 0.54
442 0.5
443 0.44
444 0.4
445 0.43
446 0.44
447 0.38
448 0.34
449 0.34
450 0.35
451 0.33
452 0.35
453 0.32
454 0.36
455 0.36
456 0.34
457 0.31
458 0.33
459 0.33
460 0.37
461 0.37
462 0.37
463 0.4
464 0.49
465 0.57
466 0.61
467 0.64
468 0.65
469 0.71
470 0.74
471 0.8
472 0.75
473 0.74
474 0.72
475 0.76
476 0.75
477 0.74
478 0.69
479 0.64
480 0.66
481 0.6
482 0.57
483 0.51
484 0.45
485 0.38
486 0.39
487 0.35
488 0.34
489 0.35
490 0.37
491 0.37
492 0.37
493 0.38
494 0.42
495 0.46
496 0.48
497 0.55
498 0.57
499 0.65
500 0.74
501 0.79
502 0.79