Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P7AE19

Protein Details
Accession A0A0P7AE19   
Localization Confidence Low
Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
214-235ALKARFAEKKQKPSRTSVRHIRHydrophilic
NLS Segment(s)
PositionSequence
251-259APKGKRRKV
Subcellular Location(s) mito 14.5, cyto_mito 10.333, nucl 7.5, cyto_nucl 6.833, cyto 5
Family & Domain DBs
Amino Acid Sequences MSTLPPTIANVPAIKATSITMPGAKPKLGKLTTPLTATFPSEITSACMTATPLSAVSFNFKPDPDFIKTPISPPLAYTDFLSKAMSLNSPAIGSGQTTPDSLPDTANSEQSDCSCKCERSSPTTSTSSASTAGASPKVSYHNMSPPATAPVVPPSPFTTSAPPMSAPPGIASFPSLKLPPSPAVSHMDSPLSASTVRSPFSARPVHSVFDWDAALKARFAEKKQKPSRTSVRHIREVVTRTVTYTPRMAPAPKGKRRKVE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.15
4 0.15
5 0.16
6 0.16
7 0.16
8 0.17
9 0.24
10 0.26
11 0.27
12 0.27
13 0.28
14 0.36
15 0.35
16 0.36
17 0.34
18 0.37
19 0.39
20 0.39
21 0.37
22 0.3
23 0.3
24 0.3
25 0.26
26 0.2
27 0.17
28 0.16
29 0.15
30 0.15
31 0.14
32 0.12
33 0.11
34 0.11
35 0.11
36 0.11
37 0.11
38 0.09
39 0.08
40 0.08
41 0.09
42 0.09
43 0.13
44 0.13
45 0.16
46 0.17
47 0.17
48 0.18
49 0.2
50 0.25
51 0.26
52 0.27
53 0.27
54 0.33
55 0.33
56 0.33
57 0.36
58 0.34
59 0.28
60 0.26
61 0.29
62 0.24
63 0.24
64 0.23
65 0.21
66 0.19
67 0.19
68 0.19
69 0.14
70 0.13
71 0.13
72 0.13
73 0.11
74 0.1
75 0.1
76 0.09
77 0.09
78 0.09
79 0.08
80 0.08
81 0.07
82 0.08
83 0.08
84 0.09
85 0.09
86 0.09
87 0.12
88 0.11
89 0.1
90 0.09
91 0.14
92 0.14
93 0.16
94 0.15
95 0.14
96 0.14
97 0.14
98 0.19
99 0.15
100 0.19
101 0.2
102 0.21
103 0.21
104 0.28
105 0.31
106 0.33
107 0.38
108 0.35
109 0.37
110 0.39
111 0.38
112 0.32
113 0.29
114 0.23
115 0.18
116 0.15
117 0.11
118 0.1
119 0.1
120 0.09
121 0.09
122 0.08
123 0.08
124 0.11
125 0.11
126 0.12
127 0.13
128 0.18
129 0.23
130 0.23
131 0.23
132 0.21
133 0.22
134 0.21
135 0.19
136 0.14
137 0.13
138 0.15
139 0.15
140 0.15
141 0.15
142 0.18
143 0.2
144 0.2
145 0.2
146 0.21
147 0.22
148 0.22
149 0.2
150 0.17
151 0.18
152 0.17
153 0.13
154 0.11
155 0.11
156 0.1
157 0.1
158 0.11
159 0.1
160 0.11
161 0.13
162 0.12
163 0.12
164 0.13
165 0.16
166 0.17
167 0.19
168 0.19
169 0.19
170 0.24
171 0.26
172 0.26
173 0.24
174 0.22
175 0.18
176 0.19
177 0.17
178 0.13
179 0.1
180 0.1
181 0.14
182 0.15
183 0.16
184 0.16
185 0.18
186 0.19
187 0.26
188 0.31
189 0.27
190 0.32
191 0.33
192 0.34
193 0.32
194 0.34
195 0.27
196 0.24
197 0.23
198 0.16
199 0.15
200 0.16
201 0.17
202 0.13
203 0.14
204 0.18
205 0.22
206 0.26
207 0.36
208 0.41
209 0.52
210 0.61
211 0.7
212 0.68
213 0.74
214 0.8
215 0.78
216 0.8
217 0.8
218 0.78
219 0.77
220 0.75
221 0.69
222 0.65
223 0.6
224 0.55
225 0.5
226 0.42
227 0.36
228 0.4
229 0.38
230 0.34
231 0.34
232 0.31
233 0.29
234 0.33
235 0.33
236 0.36
237 0.45
238 0.52
239 0.58
240 0.67