FuNGI

A0A0P7B2Y7

Protein Details

Accession

A0A0P7B2Y7

Localization Confidence

Low

Confidence Score

7.9

NoLS Segment(s)

Position	Sequence	Protein Nature
432-459	AMSEFRPRRTHKKSRGGCRPCKDRHVKC	Basic

NLS Segment(s)

Subcellular Location(s)

cyto_nucl 11, nucl 10, cyto 10, extr 4

Family & Domain DBs

InterPro	View protein in InterPro IPR005102 Carbo-bd_X2 IPR001547 Glyco_hydro_5 IPR017853 Glycoside_hydrolase_SF IPR013783 Ig-like_fold IPR036864 Zn2-C6_fun-type_DNA-bd_sf IPR001138 Zn2Cys6_DnaBD
Gene Ontology	GO:0005634 C:nucleus GO:0000981 F:DNA-binding transcription factor activity, RNA polymerase II-specific GO:0004553 F:hydrolase activity, hydrolyzing O-glycosyl compounds GO:0008270 F:zinc ion binding GO:0000272 P:polysaccharide catabolic process
Pfam	View protein in Pfam PF03442 CBM_X2 PF00150 Cellulase PF00172 Zn_clus
PROSITE	View protein in PROSITE PS00463 ZN2_CY6_FUNGAL_1 PS50048 ZN2_CY6_FUNGAL_2
CDD	cd00067 GAL4

Amino Acid Sequences

MVTSRGLYAIVNVHHDSALWADYTVSNADSAMIEEKFYRLWYQIGTKLACTSSRVAFEPLNEPRGESDEHAAQLSKLNDIFLRAIADAGGFNPQRVVTLGGLGQDIQRSIKWFERPSSEFCNPYALQVHYYAPYDFTSAAWGKTIWGSDADKAQLDDAFAELRSTFPDVPIVIGEWLVSPVHSEPAARWRYYDFLARTSIKYGFAPMMWDTGNDILDRSSHKMFDVTGVEVHLRALEGIHNSLPEATTDASAASQFSSAFAFHRVGDAIQAQTLPFSFNENLVTSIAVDDRVLAEGTDYAIIDNGIRFHSSVLSDYFDTNAAGVKATALVSFSAGASIPIQFVVWDTPTVPIASSVAVAGSEVSVAVNWRGVSKPATVAAFKADGSPLVDEWTVYLPPLGRGRTTFVPAKLNLRSFRIPTSESGLSHESRPAMSEFRPRRTHKKSRGGCRPCKDRHVKCDEIRPQCVNCLTNERQCSYTSEQLTRAPRTGALSGLLPQLSSYPMFSLQHMSLLVNVTDNPAGFIMCDEPSQAIVSDIIKPALEIQYVMDVLLALSALQRSLQNPSDSTDYRLLSIQLQGRALSVHNDSALDSSVNSILPRFIFSMLLGYSVLHDTLSSAQRDMSIFIEKFGDYLPLIQLGKTMPEITGLLSEHRKYGTSTLPWD

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.21
2	0.21
3	0.19
4	0.16
5	0.16
6	0.11
7	0.1
8	0.1
9	0.11
10	0.12
11	0.13
12	0.11
13	0.1
14	0.1
15	0.1
16	0.09
17	0.11
18	0.13
19	0.12
20	0.12
21	0.13
22	0.14
23	0.14
24	0.15
25	0.16
26	0.14
27	0.16
28	0.19
29	0.24
30	0.28
31	0.34
32	0.33
33	0.32
34	0.34
35	0.34
36	0.31
37	0.28
38	0.27
39	0.25
40	0.27
41	0.28
42	0.28
43	0.28
44	0.29
45	0.35
46	0.36
47	0.36
48	0.33
49	0.31
50	0.3
51	0.32
52	0.31
53	0.24
54	0.24
55	0.23
56	0.24
57	0.24
58	0.23
59	0.2
60	0.24
61	0.22
62	0.2
63	0.17
64	0.18
65	0.17
66	0.19
67	0.2
68	0.15
69	0.16
70	0.13
71	0.13
72	0.12
73	0.12
74	0.09
75	0.09
76	0.15
77	0.13
78	0.13
79	0.14
80	0.14
81	0.14
82	0.15
83	0.18
84	0.11
85	0.13
86	0.14
87	0.13
88	0.14
89	0.13
90	0.13
91	0.11
92	0.12
93	0.11
94	0.11
95	0.14
96	0.17
97	0.23
98	0.29
99	0.32
100	0.36
101	0.43
102	0.45
103	0.48
104	0.53
105	0.51
106	0.46
107	0.42
108	0.45
109	0.37
110	0.36
111	0.35
112	0.27
113	0.25
114	0.25
115	0.26
116	0.21
117	0.23
118	0.2
119	0.17
120	0.16
121	0.16
122	0.14
123	0.12
124	0.16
125	0.16
126	0.16
127	0.15
128	0.14
129	0.14
130	0.15
131	0.16
132	0.11
133	0.13
134	0.14
135	0.15
136	0.18
137	0.18
138	0.17
139	0.17
140	0.17
141	0.14
142	0.13
143	0.11
144	0.09
145	0.09
146	0.08
147	0.08
148	0.07
149	0.07
150	0.08
151	0.12
152	0.11
153	0.11
154	0.13
155	0.12
156	0.13
157	0.13
158	0.12
159	0.09
160	0.08
161	0.08
162	0.06
163	0.07
164	0.06
165	0.06
166	0.06
167	0.07
168	0.08
169	0.08
170	0.09
171	0.09
172	0.19
173	0.23
174	0.21
175	0.22
176	0.22
177	0.24
178	0.26
179	0.32
180	0.24
181	0.23
182	0.28
183	0.29
184	0.29
185	0.29
186	0.29
187	0.23
188	0.21
189	0.2
190	0.16
191	0.14
192	0.15
193	0.13
194	0.13
195	0.12
196	0.12
197	0.11
198	0.12
199	0.12
200	0.1
201	0.1
202	0.08
203	0.09
204	0.11
205	0.14
206	0.14
207	0.14
208	0.14
209	0.14
210	0.14
211	0.17
212	0.17
213	0.14
214	0.13
215	0.13
216	0.13
217	0.12
218	0.12
219	0.08
220	0.06
221	0.05
222	0.05
223	0.06
224	0.07
225	0.08
226	0.09
227	0.08
228	0.09
229	0.09
230	0.09
231	0.07
232	0.07
233	0.07
234	0.07
235	0.07
236	0.07
237	0.07
238	0.07
239	0.07
240	0.05
241	0.05
242	0.05
243	0.05
244	0.06
245	0.06
246	0.07
247	0.08
248	0.09
249	0.09
250	0.1
251	0.09
252	0.09
253	0.1
254	0.1
255	0.08
256	0.08
257	0.08
258	0.07
259	0.07
260	0.07
261	0.07
262	0.06
263	0.09
264	0.09
265	0.1
266	0.11
267	0.12
268	0.13
269	0.12
270	0.12
271	0.08
272	0.08
273	0.08
274	0.06
275	0.05
276	0.04
277	0.05
278	0.05
279	0.05
280	0.04
281	0.04
282	0.04
283	0.05
284	0.05
285	0.05
286	0.04
287	0.04
288	0.04
289	0.04
290	0.04
291	0.05
292	0.05
293	0.05
294	0.06
295	0.06
296	0.07
297	0.07
298	0.08
299	0.08
300	0.1
301	0.1
302	0.1
303	0.1
304	0.09
305	0.09
306	0.08
307	0.07
308	0.06
309	0.05
310	0.05
311	0.04
312	0.05
313	0.05
314	0.05
315	0.04
316	0.04
317	0.04
318	0.05
319	0.05
320	0.04
321	0.04
322	0.04
323	0.04
324	0.05
325	0.04
326	0.04
327	0.04
328	0.04
329	0.04
330	0.05
331	0.05
332	0.05
333	0.06
334	0.06
335	0.07
336	0.07
337	0.06
338	0.06
339	0.06
340	0.06
341	0.05
342	0.05
343	0.04
344	0.04
345	0.04
346	0.03
347	0.03
348	0.03
349	0.02
350	0.02
351	0.02
352	0.03
353	0.03
354	0.04
355	0.05
356	0.06
357	0.06
358	0.08
359	0.09
360	0.1
361	0.11
362	0.12
363	0.13
364	0.12
365	0.12
366	0.13
367	0.12
368	0.11
369	0.1
370	0.09
371	0.08
372	0.08
373	0.09
374	0.07
375	0.08
376	0.08
377	0.07
378	0.08
379	0.09
380	0.08
381	0.07
382	0.08
383	0.06
384	0.09
385	0.13
386	0.13
387	0.12
388	0.13
389	0.18
390	0.19
391	0.23
392	0.24
393	0.22
394	0.26
395	0.27
396	0.31
397	0.31
398	0.33
399	0.31
400	0.33
401	0.33
402	0.3
403	0.31
404	0.3
405	0.27
406	0.24
407	0.28
408	0.25
409	0.23
410	0.25
411	0.25
412	0.23
413	0.22
414	0.23
415	0.17
416	0.15
417	0.16
418	0.14
419	0.14
420	0.15
421	0.25
422	0.28
423	0.36
424	0.44
425	0.48
426	0.57
427	0.65
428	0.73
429	0.74
430	0.79
431	0.8
432	0.82
433	0.88
434	0.88
435	0.87
436	0.86
437	0.85
438	0.8
439	0.81
440	0.81
441	0.78
442	0.77
443	0.77
444	0.76
445	0.69
446	0.75
447	0.73
448	0.69
449	0.67
450	0.61
451	0.53
452	0.49
453	0.49
454	0.39
455	0.32
456	0.34
457	0.33
458	0.36
459	0.38
460	0.36
461	0.34
462	0.34
463	0.37
464	0.35
465	0.37
466	0.35
467	0.34
468	0.34
469	0.39
470	0.43
471	0.4
472	0.36
473	0.3
474	0.28
475	0.28
476	0.27
477	0.22
478	0.17
479	0.15
480	0.15
481	0.16
482	0.14
483	0.11
484	0.1
485	0.1
486	0.1
487	0.1
488	0.09
489	0.08
490	0.11
491	0.12
492	0.13
493	0.16
494	0.15
495	0.16
496	0.16
497	0.15
498	0.14
499	0.15
500	0.14
501	0.1
502	0.1
503	0.1
504	0.11
505	0.1
506	0.1
507	0.08
508	0.08
509	0.07
510	0.08
511	0.08
512	0.08
513	0.08
514	0.08
515	0.08
516	0.09
517	0.1
518	0.09
519	0.08
520	0.09
521	0.1
522	0.12
523	0.13
524	0.13
525	0.12
526	0.12
527	0.13
528	0.14
529	0.13
530	0.1
531	0.1
532	0.12
533	0.13
534	0.12
535	0.1
536	0.08
537	0.07
538	0.07
539	0.06
540	0.03
541	0.04
542	0.04
543	0.04
544	0.06
545	0.07
546	0.09
547	0.15
548	0.19
549	0.21
550	0.22
551	0.25
552	0.3
553	0.3
554	0.34
555	0.33
556	0.3
557	0.28
558	0.29
559	0.27
560	0.22
561	0.27
562	0.27
563	0.24
564	0.25
565	0.24
566	0.23
567	0.22
568	0.21
569	0.19
570	0.17
571	0.15
572	0.15
573	0.15
574	0.15
575	0.15
576	0.15
577	0.12
578	0.1
579	0.1
580	0.11
581	0.11
582	0.11
583	0.11
584	0.12
585	0.12
586	0.14
587	0.14
588	0.13
589	0.13
590	0.13
591	0.17
592	0.15
593	0.15
594	0.13
595	0.12
596	0.12
597	0.12
598	0.12
599	0.08
600	0.08
601	0.08
602	0.14
603	0.19
604	0.18
605	0.18
606	0.18
607	0.21
608	0.22
609	0.22
610	0.19
611	0.22
612	0.21
613	0.22
614	0.23
615	0.21
616	0.21
617	0.19
618	0.19
619	0.12
620	0.14
621	0.14
622	0.17
623	0.17
624	0.17
625	0.18
626	0.16
627	0.18
628	0.18
629	0.18
630	0.13
631	0.14
632	0.15
633	0.14
634	0.17
635	0.15
636	0.19
637	0.24
638	0.25
639	0.26
640	0.27
641	0.27
642	0.26
643	0.3
644	0.33

A0A0P7B2Y7

3D AlphaFold-predicted Structure Viewer