Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6FUM5

Protein Details
Accession Q6FUM5    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
98-130DDKYNSEQRRQRRIERRRRRQKTNRPASPNAYEHydrophilic
NLS Segment(s)
PositionSequence
106-122RRQRRIERRRRRQKTNR
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR011107  PPI_Ypi1  
Gene Ontology GO:0005634  C:nucleus  
GO:0000164  C:protein phosphatase type 1 complex  
GO:0072542  F:protein phosphatase activator activity  
GO:0004865  F:protein serine/threonine phosphatase inhibitor activity  
GO:0005977  P:glycogen metabolic process  
GO:0006873  P:intracellular monoatomic ion homeostasis  
GO:0007094  P:mitotic spindle assembly checkpoint signaling  
GO:1905183  P:negative regulation of protein serine/threonine phosphatase activity  
GO:0035307  P:positive regulation of protein dephosphorylation  
GO:1900180  P:regulation of protein localization to nucleus  
KEGG cgr:CAGL0F02255g  -  
Pfam View protein in Pfam  
PF07491  PPI_Ypi1  
Amino Acid Sequences MNQVSEGSRTVSVEEMPRVLQLRAANTNITEGESTSQSRNVRWEEDVVDNENMNKKKTKICCIFHPAQEEEDPEQLCPSDHEHSSSSSSSSSSESDDDDKYNSEQRRQRRIERRRRRQKTNRPASPNAYEIQPDYSEYRKRMNANV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.17
3 0.17
4 0.19
5 0.2
6 0.18
7 0.2
8 0.19
9 0.22
10 0.25
11 0.26
12 0.24
13 0.23
14 0.25
15 0.21
16 0.2
17 0.15
18 0.11
19 0.12
20 0.13
21 0.15
22 0.14
23 0.19
24 0.19
25 0.2
26 0.25
27 0.25
28 0.26
29 0.25
30 0.26
31 0.24
32 0.26
33 0.27
34 0.25
35 0.23
36 0.2
37 0.2
38 0.25
39 0.23
40 0.22
41 0.23
42 0.22
43 0.28
44 0.33
45 0.41
46 0.44
47 0.46
48 0.51
49 0.56
50 0.58
51 0.54
52 0.53
53 0.44
54 0.37
55 0.34
56 0.29
57 0.23
58 0.21
59 0.18
60 0.14
61 0.13
62 0.11
63 0.1
64 0.09
65 0.11
66 0.11
67 0.11
68 0.14
69 0.14
70 0.16
71 0.18
72 0.18
73 0.15
74 0.13
75 0.13
76 0.12
77 0.13
78 0.12
79 0.11
80 0.11
81 0.12
82 0.14
83 0.15
84 0.14
85 0.14
86 0.15
87 0.15
88 0.21
89 0.22
90 0.28
91 0.33
92 0.41
93 0.51
94 0.56
95 0.65
96 0.69
97 0.77
98 0.81
99 0.86
100 0.89
101 0.9
102 0.93
103 0.94
104 0.94
105 0.95
106 0.95
107 0.94
108 0.93
109 0.9
110 0.87
111 0.83
112 0.76
113 0.68
114 0.58
115 0.48
116 0.4
117 0.33
118 0.3
119 0.23
120 0.21
121 0.22
122 0.27
123 0.32
124 0.33
125 0.39
126 0.41