Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6FUM3

Protein Details
Accession Q6FUM3    Localization Confidence High Confidence Score 22.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MGSIKKTKGKSQSTKRVVTPHydrophilic
39-60TEKSERRKANKLQVKKEQARARHydrophilic
160-189KDELKKKSSIARSMRRKNRRDQERDLHTTSHydrophilic
NLS Segment(s)
PositionSequence
43-67ERRKANKLQVKKEQARARLYGKKKK
89-99VKLRRGKKGKK
157-179EEKKDELKKKSSIARSMRRKNRR
Subcellular Location(s) nucl 22, cyto_nucl 12.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR037650  Loc1  
Gene Ontology GO:0005730  C:nucleolus  
GO:0030687  C:preribosome, large subunit precursor  
GO:0101031  C:protein folding chaperone complex  
GO:0042802  F:identical protein binding  
GO:0003729  F:mRNA binding  
GO:0000480  P:endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000447  P:endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000472  P:endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0008298  P:intracellular mRNA localization  
GO:0051028  P:mRNA transport  
GO:0017148  P:negative regulation of translation  
GO:0042273  P:ribosomal large subunit biogenesis  
GO:0000055  P:ribosomal large subunit export from nucleus  
KEGG cgr:CAGL0F02299g  -  
Amino Acid Sequences MGSIKKTKGKSQSTKRVVTPEVFADQQARNQLANAPNLTEKSERRKANKLQVKKEQARARLYGKKKKESTYSEKDLDLPSLNKAVNPGVKLRRGKKGKKFIDDHDSLTLHRLIKTIGDKYDDITESKLEKDRRLEVIRELKRQEIERKEAAKQSQLEEKKDELKKKSSIARSMRRKNRRDQERDLHTTSNDKVQRKKKSVSFA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.78
3 0.75
4 0.68
5 0.6
6 0.52
7 0.45
8 0.4
9 0.34
10 0.31
11 0.28
12 0.26
13 0.26
14 0.28
15 0.26
16 0.22
17 0.22
18 0.27
19 0.27
20 0.3
21 0.27
22 0.24
23 0.25
24 0.25
25 0.28
26 0.27
27 0.28
28 0.33
29 0.4
30 0.45
31 0.49
32 0.57
33 0.62
34 0.68
35 0.73
36 0.74
37 0.75
38 0.78
39 0.83
40 0.8
41 0.81
42 0.76
43 0.74
44 0.69
45 0.64
46 0.61
47 0.6
48 0.62
49 0.62
50 0.63
51 0.66
52 0.66
53 0.67
54 0.68
55 0.67
56 0.67
57 0.67
58 0.65
59 0.58
60 0.54
61 0.5
62 0.42
63 0.36
64 0.28
65 0.2
66 0.15
67 0.16
68 0.15
69 0.13
70 0.14
71 0.15
72 0.15
73 0.15
74 0.19
75 0.2
76 0.27
77 0.33
78 0.36
79 0.43
80 0.5
81 0.57
82 0.62
83 0.68
84 0.69
85 0.71
86 0.71
87 0.66
88 0.65
89 0.58
90 0.5
91 0.42
92 0.36
93 0.28
94 0.26
95 0.24
96 0.17
97 0.15
98 0.14
99 0.11
100 0.13
101 0.16
102 0.17
103 0.16
104 0.18
105 0.17
106 0.18
107 0.21
108 0.19
109 0.17
110 0.15
111 0.16
112 0.14
113 0.16
114 0.21
115 0.19
116 0.22
117 0.25
118 0.28
119 0.33
120 0.36
121 0.35
122 0.37
123 0.46
124 0.48
125 0.5
126 0.48
127 0.44
128 0.44
129 0.47
130 0.48
131 0.44
132 0.45
133 0.46
134 0.47
135 0.48
136 0.5
137 0.48
138 0.45
139 0.41
140 0.38
141 0.41
142 0.42
143 0.42
144 0.39
145 0.4
146 0.43
147 0.48
148 0.52
149 0.49
150 0.51
151 0.52
152 0.55
153 0.6
154 0.59
155 0.61
156 0.64
157 0.69
158 0.73
159 0.8
160 0.84
161 0.85
162 0.85
163 0.86
164 0.87
165 0.87
166 0.85
167 0.84
168 0.84
169 0.83
170 0.84
171 0.78
172 0.7
173 0.61
174 0.58
175 0.49
176 0.49
177 0.46
178 0.45
179 0.5
180 0.56
181 0.65
182 0.68
183 0.75