Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6FMC3

Protein Details
Accession Q6FMC3   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MSWKSYKKPGHQDVNRQRNLKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 19.5, cyto_nucl 10.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
IPR019734  TPR_repeat  
KEGG cgr:CAGL0K09240g  -  
Pfam View protein in Pfam  
PF13414  TPR_11  
PROSITE View protein in PROSITE  
PS50005  TPR  
Amino Acid Sequences MSWKSYKKPGHQDVNRQRNLKHWNNGLQDKLTMSFQHFKDIGNEHFKKGEYDLAIEQYRKCISLEPTNAVGYSNLAMAYLKNRCPDEAKTACEMGLSYCKDTKLRQKLQYRLELATTNKRPKTLQQLEIREVERIPPELASL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.86
3 0.78
4 0.69
5 0.66
6 0.68
7 0.65
8 0.63
9 0.59
10 0.6
11 0.65
12 0.69
13 0.63
14 0.55
15 0.47
16 0.4
17 0.34
18 0.27
19 0.2
20 0.2
21 0.24
22 0.23
23 0.28
24 0.27
25 0.26
26 0.29
27 0.32
28 0.32
29 0.35
30 0.36
31 0.31
32 0.33
33 0.33
34 0.3
35 0.27
36 0.26
37 0.16
38 0.17
39 0.17
40 0.19
41 0.2
42 0.2
43 0.19
44 0.18
45 0.18
46 0.16
47 0.15
48 0.15
49 0.16
50 0.23
51 0.25
52 0.25
53 0.26
54 0.26
55 0.25
56 0.22
57 0.18
58 0.11
59 0.09
60 0.07
61 0.05
62 0.04
63 0.04
64 0.04
65 0.08
66 0.1
67 0.12
68 0.15
69 0.16
70 0.17
71 0.2
72 0.22
73 0.28
74 0.29
75 0.3
76 0.29
77 0.29
78 0.28
79 0.25
80 0.22
81 0.15
82 0.18
83 0.16
84 0.16
85 0.18
86 0.19
87 0.21
88 0.26
89 0.34
90 0.39
91 0.46
92 0.53
93 0.6
94 0.67
95 0.73
96 0.77
97 0.7
98 0.61
99 0.54
100 0.5
101 0.45
102 0.47
103 0.48
104 0.49
105 0.48
106 0.49
107 0.48
108 0.51
109 0.58
110 0.56
111 0.57
112 0.57
113 0.62
114 0.64
115 0.68
116 0.62
117 0.52
118 0.44
119 0.39
120 0.32
121 0.27
122 0.24