Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6FM21

Protein Details
Accession Q6FM21    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
141-187STSGGAGNKKTKQKKNKNNKDSTPVVNTSANAQSKGKNKKNKNKKKRHydrophilic
NLS Segment(s)
PositionSequence
149-157KKTKQKKNK
174-187SKGKNKKNKNKKKR
Subcellular Location(s) nucl 14, cyto 10.5, cyto_mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR039432  SRP9_dom  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
KEGG cgr:CAGL0K11660g  -  
Pfam View protein in Pfam  
PF05486  SRP9-21  
Amino Acid Sequences MSVKPIDTFIENSVKLFEANPSGSSITISYHGGAKADPVVFRTHNPHLSTTYKYQTKMNKEVSRVLNALGPRGVSMNPISKIAKRRNYLDVVKKAKQMNNSKISKKQAKLIRKAQTNPIVNTIGIGKLIANEDIKEVKTESTSGGAGNKKTKQKKNKNNKDSTPVVNTSANAQSKGKNKKNKNKKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.22
3 0.2
4 0.18
5 0.16
6 0.17
7 0.17
8 0.18
9 0.18
10 0.18
11 0.18
12 0.16
13 0.13
14 0.13
15 0.13
16 0.11
17 0.13
18 0.14
19 0.13
20 0.13
21 0.12
22 0.14
23 0.15
24 0.15
25 0.13
26 0.17
27 0.18
28 0.2
29 0.26
30 0.28
31 0.32
32 0.34
33 0.34
34 0.35
35 0.37
36 0.39
37 0.37
38 0.39
39 0.37
40 0.37
41 0.4
42 0.44
43 0.48
44 0.52
45 0.57
46 0.54
47 0.53
48 0.59
49 0.56
50 0.52
51 0.45
52 0.37
53 0.3
54 0.25
55 0.24
56 0.16
57 0.14
58 0.1
59 0.1
60 0.1
61 0.08
62 0.1
63 0.13
64 0.14
65 0.16
66 0.17
67 0.2
68 0.27
69 0.34
70 0.4
71 0.38
72 0.41
73 0.43
74 0.48
75 0.51
76 0.52
77 0.52
78 0.51
79 0.51
80 0.53
81 0.52
82 0.48
83 0.5
84 0.5
85 0.5
86 0.52
87 0.55
88 0.54
89 0.56
90 0.62
91 0.61
92 0.54
93 0.53
94 0.52
95 0.56
96 0.6
97 0.63
98 0.63
99 0.62
100 0.64
101 0.64
102 0.65
103 0.6
104 0.53
105 0.48
106 0.41
107 0.34
108 0.32
109 0.25
110 0.16
111 0.11
112 0.1
113 0.06
114 0.06
115 0.07
116 0.08
117 0.08
118 0.08
119 0.1
120 0.12
121 0.12
122 0.12
123 0.12
124 0.11
125 0.12
126 0.12
127 0.11
128 0.12
129 0.12
130 0.11
131 0.16
132 0.19
133 0.21
134 0.27
135 0.33
136 0.4
137 0.5
138 0.59
139 0.65
140 0.73
141 0.81
142 0.86
143 0.91
144 0.92
145 0.93
146 0.91
147 0.87
148 0.82
149 0.77
150 0.72
151 0.63
152 0.56
153 0.48
154 0.41
155 0.37
156 0.38
157 0.34
158 0.3
159 0.29
160 0.32
161 0.39
162 0.5
163 0.55
164 0.58
165 0.67
166 0.75
167 0.85