Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P7BC51

Protein Details
Accession A0A0P7BC51    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
113-134TGKGTGKRGRPRKNAVPTPKKEBasic
NLS Segment(s)
PositionSequence
23-60SAAGVKKSTGRPRGRPPGPNPPKVYVPTGRPRGRPKGT
80-132APRRRGRPRKGEDSPSKTPQAAPKTTPKSTTKVTGKGTGKRGRPRKNAVPTPK
Subcellular Location(s) nucl 14.5, cyto_nucl 14, cyto 10.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Amino Acid Sequences MARTKQDVTAAKDASASPPIAKSAAGVKKSTGRPRGRPPGPNPPKVYVPTGRPRGRPKGTTKAVAVAKAVDDAGNTTPEAPRRRGRPRKGEDSPSKTPQAAPKTTPKSTTKVTGKGTGKRGRPRKNAVPTPKKEEEGATDDEDQLDADIEGDAQTEDNLDVAKDAPSPADSAASNEESGDESPLE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.29
3 0.23
4 0.17
5 0.17
6 0.18
7 0.17
8 0.16
9 0.14
10 0.2
11 0.26
12 0.27
13 0.27
14 0.28
15 0.36
16 0.44
17 0.51
18 0.52
19 0.53
20 0.59
21 0.69
22 0.77
23 0.76
24 0.77
25 0.75
26 0.77
27 0.78
28 0.78
29 0.72
30 0.66
31 0.63
32 0.57
33 0.56
34 0.49
35 0.48
36 0.49
37 0.54
38 0.55
39 0.57
40 0.61
41 0.66
42 0.67
43 0.67
44 0.65
45 0.65
46 0.65
47 0.62
48 0.55
49 0.53
50 0.48
51 0.42
52 0.34
53 0.24
54 0.2
55 0.16
56 0.15
57 0.08
58 0.06
59 0.07
60 0.07
61 0.07
62 0.07
63 0.07
64 0.09
65 0.14
66 0.18
67 0.21
68 0.24
69 0.31
70 0.43
71 0.52
72 0.59
73 0.65
74 0.69
75 0.74
76 0.75
77 0.76
78 0.74
79 0.72
80 0.69
81 0.62
82 0.57
83 0.48
84 0.44
85 0.41
86 0.39
87 0.33
88 0.3
89 0.36
90 0.41
91 0.42
92 0.45
93 0.42
94 0.39
95 0.39
96 0.45
97 0.41
98 0.41
99 0.42
100 0.45
101 0.47
102 0.49
103 0.56
104 0.54
105 0.56
106 0.59
107 0.67
108 0.68
109 0.72
110 0.74
111 0.75
112 0.79
113 0.81
114 0.82
115 0.83
116 0.79
117 0.79
118 0.75
119 0.66
120 0.57
121 0.49
122 0.43
123 0.37
124 0.35
125 0.29
126 0.26
127 0.25
128 0.23
129 0.22
130 0.17
131 0.12
132 0.09
133 0.06
134 0.05
135 0.05
136 0.05
137 0.05
138 0.05
139 0.05
140 0.05
141 0.05
142 0.05
143 0.05
144 0.05
145 0.05
146 0.05
147 0.06
148 0.06
149 0.07
150 0.08
151 0.08
152 0.09
153 0.1
154 0.11
155 0.11
156 0.13
157 0.12
158 0.14
159 0.18
160 0.19
161 0.18
162 0.17
163 0.17
164 0.17
165 0.17