Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6FVS4

Protein Details
Accession Q6FVS4   
Localization Confidence Medium
Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
303-326AFKETSKARRRRHTAKSKIQTIKQHydrophilic
NLS Segment(s)
PositionSequence
305-318KETSKARRRRHTAK
Subcellular Location(s) nucl 22.5, cyto_nucl 13.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR034586  Bfa1/Byr4  
Gene Ontology GO:1990334  C:Bfa1-Bub2 complex  
GO:0005092  F:GDP-dissociation inhibitor activity  
GO:0005096  F:GTPase activator activity  
GO:0031578  P:mitotic spindle orientation checkpoint signaling  
GO:0043547  P:positive regulation of GTPase activity  
KEGG cgr:CAGL0D06028g  -  
Amino Acid Sequences MSIRPANMMDYDLPETSFEDIDATFSRDVPTSSVRNTLDMQQSMPVEDRKVLQEIVQPTPSSITTSDTGTIFSGSRKQSWLNNLASDEDKSDGFEDGEEFLSDFQEFQNRKDDFDEAIKSHFNLQKRSCRGDYDLATDFERKVNINPNSQRRSLRQPRSMMDMHPLRSENSFNPHRLQNSISTNNLHRPNRLGSLHFKKSMPSLSSYNPVIEEEPRYWKKSWDIEEAEEDDDYFDEDFDEDGQETFDLDEKTLKNRVQSNIPTSKTPFKISPTQFDIIQQDDLLTPRLHKKQKELRYKHNLEAFKETSKARRRRHTAKSKIQTIKQQIDHNTPMKSGLMYYNPKKMAWEGNERVLDKFQDIISIDKRPLLIRNKSNISPNETLTYTGSDNNNVQDNGSNSTFSSTTNPRVVGKMMFDERNLRWVSVNNDEIDPFAEIEENIPEPILGKPKRSSPFLRSRSQLISSNNPEVSFTESDVPGNDKFAIGVKKRDRYASTSAAISKRAGDRADMERVYRLSSKELERLYHEENRWQRKVGGWFVLGDGDQQDRTMAQYDPSDKGNNFMYEIRKMVINSTKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.2
3 0.19
4 0.17
5 0.13
6 0.11
7 0.11
8 0.13
9 0.14
10 0.16
11 0.15
12 0.15
13 0.17
14 0.17
15 0.18
16 0.18
17 0.23
18 0.24
19 0.25
20 0.32
21 0.31
22 0.33
23 0.35
24 0.38
25 0.39
26 0.36
27 0.35
28 0.32
29 0.32
30 0.31
31 0.32
32 0.28
33 0.22
34 0.23
35 0.24
36 0.23
37 0.25
38 0.24
39 0.23
40 0.27
41 0.29
42 0.33
43 0.34
44 0.31
45 0.28
46 0.3
47 0.28
48 0.24
49 0.2
50 0.19
51 0.17
52 0.18
53 0.2
54 0.18
55 0.18
56 0.16
57 0.17
58 0.14
59 0.15
60 0.2
61 0.2
62 0.23
63 0.24
64 0.27
65 0.32
66 0.39
67 0.45
68 0.41
69 0.41
70 0.4
71 0.4
72 0.39
73 0.34
74 0.27
75 0.21
76 0.18
77 0.15
78 0.15
79 0.13
80 0.12
81 0.11
82 0.11
83 0.11
84 0.12
85 0.1
86 0.1
87 0.09
88 0.1
89 0.09
90 0.08
91 0.08
92 0.15
93 0.16
94 0.18
95 0.27
96 0.27
97 0.29
98 0.3
99 0.32
100 0.26
101 0.3
102 0.33
103 0.24
104 0.27
105 0.26
106 0.25
107 0.31
108 0.32
109 0.31
110 0.35
111 0.41
112 0.48
113 0.53
114 0.6
115 0.54
116 0.54
117 0.55
118 0.54
119 0.49
120 0.45
121 0.42
122 0.36
123 0.36
124 0.34
125 0.29
126 0.23
127 0.22
128 0.18
129 0.18
130 0.26
131 0.29
132 0.37
133 0.44
134 0.52
135 0.56
136 0.6
137 0.61
138 0.56
139 0.63
140 0.64
141 0.66
142 0.64
143 0.64
144 0.62
145 0.64
146 0.61
147 0.51
148 0.49
149 0.44
150 0.38
151 0.36
152 0.35
153 0.29
154 0.29
155 0.3
156 0.24
157 0.27
158 0.3
159 0.29
160 0.31
161 0.34
162 0.34
163 0.33
164 0.32
165 0.31
166 0.34
167 0.35
168 0.34
169 0.33
170 0.34
171 0.39
172 0.45
173 0.4
174 0.34
175 0.34
176 0.36
177 0.39
178 0.38
179 0.34
180 0.35
181 0.42
182 0.46
183 0.45
184 0.42
185 0.38
186 0.39
187 0.41
188 0.33
189 0.28
190 0.27
191 0.26
192 0.3
193 0.29
194 0.26
195 0.22
196 0.21
197 0.18
198 0.16
199 0.16
200 0.14
201 0.23
202 0.25
203 0.29
204 0.28
205 0.3
206 0.34
207 0.38
208 0.41
209 0.4
210 0.4
211 0.38
212 0.4
213 0.39
214 0.34
215 0.26
216 0.21
217 0.13
218 0.11
219 0.09
220 0.07
221 0.05
222 0.04
223 0.05
224 0.05
225 0.05
226 0.05
227 0.05
228 0.05
229 0.05
230 0.05
231 0.05
232 0.05
233 0.07
234 0.07
235 0.07
236 0.11
237 0.11
238 0.14
239 0.19
240 0.2
241 0.21
242 0.26
243 0.28
244 0.32
245 0.35
246 0.39
247 0.42
248 0.42
249 0.4
250 0.38
251 0.42
252 0.37
253 0.36
254 0.31
255 0.28
256 0.36
257 0.36
258 0.38
259 0.36
260 0.36
261 0.33
262 0.33
263 0.31
264 0.23
265 0.21
266 0.15
267 0.11
268 0.1
269 0.11
270 0.1
271 0.09
272 0.09
273 0.15
274 0.23
275 0.27
276 0.28
277 0.37
278 0.45
279 0.55
280 0.64
281 0.65
282 0.67
283 0.73
284 0.76
285 0.71
286 0.68
287 0.61
288 0.53
289 0.53
290 0.45
291 0.35
292 0.34
293 0.3
294 0.32
295 0.38
296 0.46
297 0.46
298 0.53
299 0.6
300 0.67
301 0.77
302 0.8
303 0.81
304 0.82
305 0.83
306 0.83
307 0.81
308 0.75
309 0.72
310 0.69
311 0.65
312 0.59
313 0.56
314 0.49
315 0.49
316 0.5
317 0.46
318 0.39
319 0.32
320 0.29
321 0.24
322 0.2
323 0.16
324 0.12
325 0.15
326 0.21
327 0.23
328 0.29
329 0.3
330 0.3
331 0.3
332 0.3
333 0.3
334 0.29
335 0.36
336 0.31
337 0.36
338 0.4
339 0.4
340 0.39
341 0.33
342 0.29
343 0.2
344 0.19
345 0.13
346 0.12
347 0.12
348 0.14
349 0.15
350 0.17
351 0.17
352 0.17
353 0.18
354 0.16
355 0.23
356 0.27
357 0.33
358 0.37
359 0.43
360 0.47
361 0.48
362 0.54
363 0.5
364 0.49
365 0.44
366 0.39
367 0.35
368 0.31
369 0.3
370 0.24
371 0.23
372 0.17
373 0.18
374 0.17
375 0.17
376 0.17
377 0.18
378 0.2
379 0.18
380 0.17
381 0.16
382 0.17
383 0.19
384 0.18
385 0.17
386 0.14
387 0.16
388 0.15
389 0.14
390 0.18
391 0.17
392 0.21
393 0.24
394 0.25
395 0.24
396 0.26
397 0.26
398 0.23
399 0.21
400 0.21
401 0.23
402 0.23
403 0.23
404 0.27
405 0.25
406 0.31
407 0.3
408 0.25
409 0.22
410 0.25
411 0.28
412 0.28
413 0.31
414 0.25
415 0.25
416 0.24
417 0.23
418 0.21
419 0.17
420 0.11
421 0.09
422 0.08
423 0.07
424 0.08
425 0.09
426 0.09
427 0.08
428 0.08
429 0.07
430 0.08
431 0.1
432 0.19
433 0.19
434 0.23
435 0.26
436 0.34
437 0.39
438 0.44
439 0.48
440 0.48
441 0.57
442 0.59
443 0.63
444 0.58
445 0.58
446 0.57
447 0.55
448 0.52
449 0.46
450 0.49
451 0.48
452 0.51
453 0.47
454 0.42
455 0.39
456 0.33
457 0.34
458 0.26
459 0.22
460 0.2
461 0.19
462 0.2
463 0.2
464 0.22
465 0.17
466 0.18
467 0.16
468 0.12
469 0.12
470 0.17
471 0.24
472 0.24
473 0.34
474 0.4
475 0.46
476 0.49
477 0.55
478 0.53
479 0.51
480 0.55
481 0.52
482 0.46
483 0.43
484 0.46
485 0.42
486 0.4
487 0.35
488 0.33
489 0.3
490 0.32
491 0.29
492 0.25
493 0.28
494 0.32
495 0.39
496 0.35
497 0.33
498 0.33
499 0.33
500 0.35
501 0.33
502 0.3
503 0.26
504 0.31
505 0.34
506 0.37
507 0.39
508 0.38
509 0.39
510 0.43
511 0.45
512 0.48
513 0.45
514 0.48
515 0.54
516 0.61
517 0.59
518 0.56
519 0.52
520 0.51
521 0.56
522 0.54
523 0.5
524 0.42
525 0.39
526 0.37
527 0.37
528 0.3
529 0.23
530 0.18
531 0.15
532 0.14
533 0.13
534 0.13
535 0.11
536 0.13
537 0.15
538 0.14
539 0.14
540 0.2
541 0.24
542 0.26
543 0.3
544 0.34
545 0.31
546 0.34
547 0.36
548 0.32
549 0.31
550 0.33
551 0.34
552 0.32
553 0.34
554 0.32
555 0.3
556 0.29
557 0.33