Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0P7AY54

Protein Details
Accession A0A0P7AY54    Localization Confidence Medium Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPISKKDRRTKEHKKAEAAGBasic
NLS Segment(s)
PositionSequence
5-19KKDRRTKEHKKAEAA
Subcellular Location(s) nucl 21.5, cyto_nucl 12.5, mito 3
Family & Domain DBs
Amino Acid Sequences MPISKKDRRTKEHKKAEAAGTRTPVKANGLPVKPPKPTSICQNCRKEIVNTNKIQLEVHATTHDEKLWPKEKCWPNDFQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.83
2 0.79
3 0.79
4 0.76
5 0.69
6 0.61
7 0.55
8 0.5
9 0.43
10 0.38
11 0.3
12 0.26
13 0.24
14 0.27
15 0.3
16 0.29
17 0.33
18 0.39
19 0.42
20 0.4
21 0.4
22 0.38
23 0.34
24 0.35
25 0.4
26 0.44
27 0.49
28 0.56
29 0.6
30 0.57
31 0.56
32 0.56
33 0.5
34 0.48
35 0.5
36 0.49
37 0.44
38 0.46
39 0.44
40 0.42
41 0.38
42 0.3
43 0.27
44 0.19
45 0.19
46 0.17
47 0.18
48 0.19
49 0.21
50 0.21
51 0.17
52 0.18
53 0.26
54 0.33
55 0.34
56 0.34
57 0.43
58 0.51
59 0.57