Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P7B977

Protein Details
Accession A0A0P7B977   
Localization Confidence Medium
Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
182-208QEEPFTPKRPAKRAKVTPKPKVEPEEHBasic
NLS Segment(s)
PositionSequence
141-157RAKATPRKRATPAKKSK
189-201KRPAKRAKVTPKP
Subcellular Location(s) nucl 16.5, cyto_nucl 11.333, cyto 5, cyto_mito 4.333, pero 3
Family & Domain DBs
Amino Acid Sequences MPPKAGGTVWDNSEFLMELGVSFFLAAQENGGISPEVRKSIVDHLQNRGFSITWEAIRTMAGRQTMKWDANVHEDILICLFQHLKLSTTDWTSVMNDLKVMGYTFTESALRQHVQKLRRNRDADGVQATVGGSSPATSTPRAKATPRKRATPAKKSKAMANLEEEDEQNEKLNLKLEMDSDQEEPFTPKRPAKRAKVTPKPKVEPEEHMEMEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.15
3 0.12
4 0.08
5 0.06
6 0.07
7 0.07
8 0.06
9 0.05
10 0.05
11 0.05
12 0.07
13 0.07
14 0.06
15 0.07
16 0.07
17 0.07
18 0.08
19 0.07
20 0.06
21 0.1
22 0.11
23 0.13
24 0.13
25 0.13
26 0.15
27 0.22
28 0.3
29 0.34
30 0.36
31 0.41
32 0.46
33 0.46
34 0.44
35 0.38
36 0.3
37 0.23
38 0.24
39 0.2
40 0.16
41 0.17
42 0.16
43 0.15
44 0.15
45 0.16
46 0.12
47 0.12
48 0.16
49 0.15
50 0.15
51 0.21
52 0.25
53 0.26
54 0.26
55 0.26
56 0.24
57 0.29
58 0.29
59 0.23
60 0.2
61 0.19
62 0.17
63 0.15
64 0.13
65 0.07
66 0.06
67 0.06
68 0.05
69 0.08
70 0.08
71 0.09
72 0.1
73 0.12
74 0.13
75 0.14
76 0.15
77 0.13
78 0.13
79 0.13
80 0.14
81 0.13
82 0.11
83 0.1
84 0.09
85 0.09
86 0.08
87 0.07
88 0.05
89 0.04
90 0.05
91 0.05
92 0.06
93 0.06
94 0.06
95 0.07
96 0.1
97 0.11
98 0.11
99 0.16
100 0.21
101 0.27
102 0.34
103 0.43
104 0.49
105 0.57
106 0.58
107 0.54
108 0.57
109 0.51
110 0.48
111 0.4
112 0.32
113 0.23
114 0.21
115 0.19
116 0.11
117 0.1
118 0.07
119 0.04
120 0.04
121 0.04
122 0.05
123 0.07
124 0.09
125 0.11
126 0.14
127 0.19
128 0.21
129 0.26
130 0.35
131 0.44
132 0.53
133 0.56
134 0.59
135 0.63
136 0.71
137 0.76
138 0.77
139 0.78
140 0.76
141 0.78
142 0.74
143 0.71
144 0.69
145 0.64
146 0.55
147 0.5
148 0.43
149 0.38
150 0.38
151 0.32
152 0.26
153 0.23
154 0.2
155 0.16
156 0.14
157 0.13
158 0.12
159 0.15
160 0.14
161 0.14
162 0.15
163 0.15
164 0.16
165 0.18
166 0.2
167 0.19
168 0.18
169 0.17
170 0.17
171 0.2
172 0.19
173 0.22
174 0.26
175 0.3
176 0.39
177 0.48
178 0.57
179 0.63
180 0.72
181 0.78
182 0.83
183 0.88
184 0.9
185 0.9
186 0.91
187 0.88
188 0.85
189 0.82
190 0.75
191 0.72
192 0.67
193 0.66