Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0P7B9F5

Protein Details
Accession A0A0P7B9F5    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
20-43ASSARIKKSKKTNNVKFKVRCQKHHydrophilic
NLS Segment(s)
PositionSequence
24-30RIKKSKK
Subcellular Location(s) nucl 22, mito_nucl 13.833, cyto_nucl 11.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPKEVADIKKFIEICRRKDASSARIKKSKKTNNVKFKVRCQKHLYTLVLKDSDKAEKLKQSLPPTLQLTDVSKKAKST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.49
3 0.5
4 0.45
5 0.51
6 0.55
7 0.53
8 0.57
9 0.6
10 0.57
11 0.63
12 0.64
13 0.65
14 0.69
15 0.69
16 0.69
17 0.72
18 0.75
19 0.78
20 0.84
21 0.86
22 0.8
23 0.8
24 0.81
25 0.73
26 0.7
27 0.66
28 0.62
29 0.59
30 0.61
31 0.54
32 0.48
33 0.47
34 0.43
35 0.39
36 0.34
37 0.29
38 0.24
39 0.24
40 0.21
41 0.22
42 0.23
43 0.26
44 0.29
45 0.33
46 0.38
47 0.4
48 0.44
49 0.44
50 0.47
51 0.45
52 0.42
53 0.39
54 0.34
55 0.34
56 0.33
57 0.36
58 0.33