Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0P7BIY9

Protein Details
Accession A0A0P7BIY9    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MGNPKLTRRRRRTDTLKKKVREYSDBasic
NLS Segment(s)
PositionSequence
8-13RRRRRT
Subcellular Location(s) nucl 19, cyto 4, mito 3
Family & Domain DBs
Amino Acid Sequences MGNPKLTRRRRRTDTLKKKVREYSDIFGVDVAIVLQDRSTLQRQIFTFSDDPDWDIAPNEPAQPMESAALNVGWTAWNEVDRLKERFRRLNLECPP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.89
3 0.9
4 0.84
5 0.84
6 0.81
7 0.76
8 0.72
9 0.66
10 0.6
11 0.57
12 0.52
13 0.45
14 0.37
15 0.31
16 0.23
17 0.17
18 0.11
19 0.04
20 0.03
21 0.03
22 0.03
23 0.03
24 0.04
25 0.07
26 0.09
27 0.13
28 0.13
29 0.17
30 0.18
31 0.22
32 0.22
33 0.23
34 0.21
35 0.19
36 0.2
37 0.16
38 0.17
39 0.13
40 0.13
41 0.09
42 0.09
43 0.08
44 0.08
45 0.09
46 0.09
47 0.08
48 0.08
49 0.09
50 0.09
51 0.09
52 0.09
53 0.08
54 0.08
55 0.08
56 0.08
57 0.07
58 0.06
59 0.05
60 0.05
61 0.05
62 0.07
63 0.08
64 0.08
65 0.09
66 0.11
67 0.17
68 0.21
69 0.25
70 0.31
71 0.38
72 0.45
73 0.54
74 0.58
75 0.62
76 0.62