Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P7AMZ1

Protein Details
Accession A0A0P7AMZ1   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
41-60SSLPRASRHNARRPERKPLSHydrophilic
NLS Segment(s)
PositionSequence
11-20RPGRPRSLHP
25-27RSR
45-56RASRHNARRPER
Subcellular Location(s) mito 17, nucl 5, cyto 5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR018790  DUF2358  
IPR031342  Mug163-like  
Pfam View protein in Pfam  
PF17119  MMU163  
Amino Acid Sequences MAAPFRSVLRRPGRPRSLHPASLARSRPLSRFSPAKAQVASSLPRASRHNARRPERKPLSQTYFDATGLKWAGAGAEGPNDPNKAKLGKTLRVLQDRLPTLLQSPLPHDILAPNISLHLFPSTHPHLPVVSGRVAYNAALWTSPIAWNRVPIIGNVRLEILAERMTSEPLTFLPRRPGAMPEQLVVRWCEKRKEPSLSSGRSAVSAIARSLPWVGRGVDPNKAFTGLFIFDFDSEGRILSHTIEQAQAGGDWEGGVGAKFVGLTDWLLGGLKGPGDTPIPMFARQRRRRPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.77
3 0.78
4 0.77
5 0.71
6 0.68
7 0.65
8 0.6
9 0.62
10 0.58
11 0.52
12 0.5
13 0.49
14 0.47
15 0.44
16 0.43
17 0.41
18 0.44
19 0.44
20 0.48
21 0.49
22 0.51
23 0.46
24 0.44
25 0.42
26 0.4
27 0.38
28 0.31
29 0.32
30 0.27
31 0.3
32 0.33
33 0.35
34 0.41
35 0.48
36 0.54
37 0.59
38 0.68
39 0.75
40 0.76
41 0.82
42 0.8
43 0.78
44 0.76
45 0.76
46 0.74
47 0.68
48 0.66
49 0.59
50 0.53
51 0.45
52 0.39
53 0.28
54 0.25
55 0.2
56 0.18
57 0.13
58 0.11
59 0.1
60 0.09
61 0.1
62 0.06
63 0.07
64 0.08
65 0.09
66 0.11
67 0.13
68 0.13
69 0.13
70 0.16
71 0.15
72 0.16
73 0.23
74 0.28
75 0.32
76 0.36
77 0.42
78 0.46
79 0.5
80 0.51
81 0.46
82 0.47
83 0.42
84 0.4
85 0.33
86 0.26
87 0.22
88 0.23
89 0.21
90 0.15
91 0.17
92 0.18
93 0.18
94 0.17
95 0.16
96 0.14
97 0.14
98 0.14
99 0.11
100 0.08
101 0.08
102 0.08
103 0.08
104 0.08
105 0.08
106 0.07
107 0.07
108 0.13
109 0.17
110 0.18
111 0.18
112 0.18
113 0.17
114 0.18
115 0.19
116 0.16
117 0.13
118 0.12
119 0.12
120 0.12
121 0.12
122 0.1
123 0.1
124 0.07
125 0.06
126 0.06
127 0.06
128 0.05
129 0.06
130 0.08
131 0.08
132 0.11
133 0.1
134 0.12
135 0.12
136 0.14
137 0.14
138 0.12
139 0.15
140 0.16
141 0.17
142 0.16
143 0.15
144 0.13
145 0.13
146 0.13
147 0.09
148 0.06
149 0.06
150 0.07
151 0.07
152 0.08
153 0.08
154 0.07
155 0.07
156 0.07
157 0.13
158 0.13
159 0.14
160 0.2
161 0.21
162 0.22
163 0.23
164 0.25
165 0.23
166 0.29
167 0.28
168 0.22
169 0.23
170 0.22
171 0.22
172 0.21
173 0.21
174 0.21
175 0.23
176 0.27
177 0.31
178 0.38
179 0.44
180 0.51
181 0.49
182 0.53
183 0.58
184 0.57
185 0.53
186 0.48
187 0.41
188 0.33
189 0.32
190 0.23
191 0.17
192 0.14
193 0.12
194 0.11
195 0.11
196 0.11
197 0.13
198 0.12
199 0.11
200 0.13
201 0.14
202 0.15
203 0.22
204 0.23
205 0.28
206 0.29
207 0.3
208 0.28
209 0.28
210 0.25
211 0.19
212 0.2
213 0.14
214 0.14
215 0.12
216 0.12
217 0.11
218 0.13
219 0.12
220 0.1
221 0.09
222 0.09
223 0.08
224 0.08
225 0.09
226 0.09
227 0.12
228 0.12
229 0.13
230 0.13
231 0.13
232 0.13
233 0.13
234 0.11
235 0.1
236 0.09
237 0.08
238 0.07
239 0.06
240 0.06
241 0.06
242 0.05
243 0.04
244 0.04
245 0.04
246 0.04
247 0.04
248 0.05
249 0.05
250 0.06
251 0.06
252 0.06
253 0.07
254 0.07
255 0.07
256 0.08
257 0.08
258 0.08
259 0.07
260 0.08
261 0.09
262 0.11
263 0.12
264 0.12
265 0.18
266 0.2
267 0.24
268 0.31
269 0.38
270 0.47
271 0.56