Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

B4UN08

Protein Details
Accession B4UN08    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
43-68AKKHVLFKESKKRKVPERKPLDFLRTBasic
NLS Segment(s)
PositionSequence
49-62FKESKKRKVPERKP
Subcellular Location(s) mito 25, cyto 1.5, cyto_nucl 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038584  L33_sf  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cgr:CAGL0H04691g  -  
Amino Acid Sequences MAKVKAKNTVVKLVSTALTGYSRFISVKKGAPLVTQVRYDPIAKKHVLFKESKKRKVPERKPLDFLRTSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.24
3 0.2
4 0.13
5 0.12
6 0.12
7 0.12
8 0.1
9 0.11
10 0.11
11 0.11
12 0.14
13 0.16
14 0.2
15 0.2
16 0.22
17 0.21
18 0.21
19 0.25
20 0.25
21 0.24
22 0.21
23 0.19
24 0.19
25 0.2
26 0.21
27 0.2
28 0.2
29 0.22
30 0.22
31 0.24
32 0.3
33 0.33
34 0.35
35 0.36
36 0.42
37 0.49
38 0.58
39 0.65
40 0.67
41 0.69
42 0.76
43 0.83
44 0.84
45 0.83
46 0.84
47 0.82
48 0.8
49 0.81
50 0.78