Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P7AWL5

Protein Details
Accession A0A0P7AWL5   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
49-70VDENGRRKRWRRKDTSPEVKDGBasic
NLS Segment(s)
PositionSequence
54-61RRKRWRRK
Subcellular Location(s) mito 15.5, cyto_mito 10.5, cyto 4.5, plas 3, nucl 2
Family & Domain DBs
Amino Acid Sequences MPPLLHPKSRMTSSLFATTVAASFFVVTLPHLLPCPVPRARFADGEIMVDENGRRKRWRRKDTSPEVKDGIVQFNDTTAEEIEQAKLRSQRECPIPKPGGMLGEWLGFHKSESESEQGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.38
3 0.32
4 0.3
5 0.27
6 0.21
7 0.17
8 0.13
9 0.07
10 0.07
11 0.06
12 0.06
13 0.05
14 0.05
15 0.08
16 0.08
17 0.08
18 0.09
19 0.09
20 0.1
21 0.12
22 0.17
23 0.18
24 0.19
25 0.21
26 0.26
27 0.29
28 0.29
29 0.29
30 0.28
31 0.25
32 0.25
33 0.22
34 0.17
35 0.14
36 0.13
37 0.12
38 0.12
39 0.15
40 0.17
41 0.21
42 0.29
43 0.4
44 0.51
45 0.61
46 0.64
47 0.71
48 0.79
49 0.86
50 0.89
51 0.81
52 0.73
53 0.64
54 0.55
55 0.47
56 0.37
57 0.3
58 0.19
59 0.17
60 0.13
61 0.12
62 0.13
63 0.11
64 0.1
65 0.07
66 0.07
67 0.08
68 0.09
69 0.1
70 0.12
71 0.12
72 0.15
73 0.2
74 0.21
75 0.24
76 0.27
77 0.32
78 0.39
79 0.46
80 0.45
81 0.5
82 0.51
83 0.48
84 0.48
85 0.43
86 0.35
87 0.28
88 0.27
89 0.19
90 0.18
91 0.18
92 0.16
93 0.15
94 0.13
95 0.13
96 0.13
97 0.14
98 0.14
99 0.18