Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P7BF78

Protein Details
Accession A0A0P7BF78   
Localization Confidence Medium
Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
70-90IIQQQIKTRRRRGSLRKVALLHydrophilic
NLS Segment(s)
PositionSequence
77-99TRRRRGSLRKVALLGRGAQREKK
Subcellular Location(s) plas 19, nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR029164  PIG-Y  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF15159  PIG-Y  
Amino Acid Sequences MEGTGRVQHDGSPTSPTPSHSHRKTPSGSGLLSRFPFMKPSQDFKSEPDRDVTDPTPAASRSTPRASSAIIQQQIKTRRRRGSLRKVALLGRGAQREKKESKQLTIDTSHAAAFGLDHTTSTQTQSPEQFTAVDYDNGLAPTPHPTTNPFPATSSIANPSTIPTDGATSQPDPDTHGSYTSTDEEDILQIPKGAAALRQSLAMASGPDSYFGGLGADTTQRRRSIHRAKSPLSYSGLSTSTLPVHDTEWDYSDTEWWGWVVLCVTWFVFVIGMGSCFDVWSWAWDVGKTPYAPPELEDDPTLPVVGYYPALIILTGIMAWVWVLTAWVGMKYFRHAKISGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.32
4 0.34
5 0.39
6 0.49
7 0.47
8 0.56
9 0.57
10 0.64
11 0.65
12 0.65
13 0.65
14 0.6
15 0.56
16 0.52
17 0.48
18 0.46
19 0.42
20 0.37
21 0.31
22 0.26
23 0.29
24 0.25
25 0.32
26 0.31
27 0.37
28 0.41
29 0.46
30 0.47
31 0.47
32 0.56
33 0.51
34 0.47
35 0.45
36 0.42
37 0.38
38 0.42
39 0.38
40 0.32
41 0.29
42 0.28
43 0.27
44 0.24
45 0.25
46 0.22
47 0.25
48 0.26
49 0.31
50 0.32
51 0.31
52 0.32
53 0.31
54 0.31
55 0.34
56 0.36
57 0.35
58 0.35
59 0.35
60 0.41
61 0.49
62 0.54
63 0.55
64 0.56
65 0.59
66 0.65
67 0.74
68 0.77
69 0.79
70 0.83
71 0.8
72 0.76
73 0.72
74 0.66
75 0.6
76 0.51
77 0.44
78 0.38
79 0.37
80 0.34
81 0.35
82 0.36
83 0.4
84 0.43
85 0.45
86 0.5
87 0.47
88 0.49
89 0.52
90 0.52
91 0.48
92 0.46
93 0.41
94 0.32
95 0.29
96 0.24
97 0.17
98 0.15
99 0.1
100 0.07
101 0.07
102 0.07
103 0.06
104 0.06
105 0.07
106 0.09
107 0.1
108 0.12
109 0.14
110 0.14
111 0.17
112 0.19
113 0.22
114 0.2
115 0.2
116 0.18
117 0.16
118 0.17
119 0.16
120 0.13
121 0.1
122 0.1
123 0.1
124 0.1
125 0.09
126 0.07
127 0.06
128 0.1
129 0.12
130 0.12
131 0.12
132 0.16
133 0.2
134 0.26
135 0.28
136 0.24
137 0.23
138 0.24
139 0.26
140 0.23
141 0.21
142 0.18
143 0.16
144 0.16
145 0.15
146 0.14
147 0.12
148 0.12
149 0.11
150 0.08
151 0.08
152 0.09
153 0.1
154 0.11
155 0.1
156 0.1
157 0.11
158 0.1
159 0.12
160 0.13
161 0.14
162 0.13
163 0.13
164 0.13
165 0.14
166 0.15
167 0.14
168 0.12
169 0.1
170 0.1
171 0.09
172 0.09
173 0.09
174 0.08
175 0.07
176 0.06
177 0.06
178 0.06
179 0.06
180 0.06
181 0.06
182 0.07
183 0.09
184 0.09
185 0.1
186 0.09
187 0.09
188 0.09
189 0.08
190 0.07
191 0.06
192 0.07
193 0.07
194 0.07
195 0.08
196 0.07
197 0.07
198 0.06
199 0.06
200 0.04
201 0.04
202 0.05
203 0.08
204 0.09
205 0.12
206 0.16
207 0.18
208 0.2
209 0.25
210 0.34
211 0.42
212 0.51
213 0.57
214 0.62
215 0.62
216 0.67
217 0.65
218 0.58
219 0.51
220 0.42
221 0.33
222 0.28
223 0.26
224 0.2
225 0.18
226 0.16
227 0.13
228 0.13
229 0.13
230 0.11
231 0.11
232 0.12
233 0.14
234 0.14
235 0.15
236 0.16
237 0.16
238 0.15
239 0.16
240 0.14
241 0.12
242 0.11
243 0.09
244 0.08
245 0.08
246 0.08
247 0.07
248 0.06
249 0.07
250 0.07
251 0.07
252 0.07
253 0.07
254 0.07
255 0.06
256 0.06
257 0.06
258 0.06
259 0.06
260 0.06
261 0.07
262 0.06
263 0.06
264 0.06
265 0.07
266 0.07
267 0.09
268 0.12
269 0.13
270 0.14
271 0.14
272 0.17
273 0.18
274 0.22
275 0.2
276 0.19
277 0.22
278 0.24
279 0.24
280 0.23
281 0.26
282 0.24
283 0.24
284 0.24
285 0.21
286 0.2
287 0.2
288 0.19
289 0.13
290 0.11
291 0.1
292 0.1
293 0.09
294 0.07
295 0.07
296 0.07
297 0.07
298 0.07
299 0.06
300 0.05
301 0.05
302 0.04
303 0.04
304 0.03
305 0.03
306 0.03
307 0.03
308 0.03
309 0.03
310 0.03
311 0.04
312 0.05
313 0.06
314 0.08
315 0.09
316 0.1
317 0.12
318 0.19
319 0.27
320 0.29
321 0.33