Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

Q6FRK0

Protein Details
Accession Q6FRK0    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
39-58SGSVRDKKNTSNKQVNKPDIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 7.333, plas 5, mito 4.5, cyto_mito 4.333, cyto 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009445  TMEM85/Emc4  
Gene Ontology GO:0072546  C:EMC complex  
GO:0032977  F:membrane insertase activity  
GO:0006644  P:phospholipid metabolic process  
GO:0015914  P:phospholipid transport  
GO:0045050  P:protein insertion into ER membrane by stop-transfer membrane-anchor sequence  
KEGG cgr:CAGL0H07953g  -  
Pfam View protein in Pfam  
PF06417  DUF1077  
Amino Acid Sequences MVSANTEEWVENLLNPQIVKEWQQSTVNTPSPQGYQGLSGSVRDKKNTSNKQVNKPDIANLQVQKAWEIALQPAKSIPMNFFMSYMSGTSLQIIPIMTALMLLSGPVKSIFTIRETFKPVLGNPKSQNQIYLMMILYVAFQGVLMFIGLKKLNDMGLIPNKTSDWMAWEKITDYNKGIRVFSF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.15
4 0.15
5 0.16
6 0.2
7 0.23
8 0.23
9 0.26
10 0.3
11 0.31
12 0.33
13 0.39
14 0.4
15 0.35
16 0.34
17 0.32
18 0.3
19 0.3
20 0.26
21 0.19
22 0.16
23 0.16
24 0.17
25 0.15
26 0.15
27 0.18
28 0.23
29 0.25
30 0.25
31 0.27
32 0.33
33 0.43
34 0.51
35 0.56
36 0.6
37 0.66
38 0.73
39 0.81
40 0.77
41 0.71
42 0.63
43 0.57
44 0.49
45 0.44
46 0.38
47 0.3
48 0.27
49 0.24
50 0.23
51 0.19
52 0.17
53 0.15
54 0.1
55 0.09
56 0.11
57 0.15
58 0.14
59 0.14
60 0.14
61 0.15
62 0.15
63 0.15
64 0.13
65 0.12
66 0.14
67 0.14
68 0.14
69 0.13
70 0.13
71 0.13
72 0.12
73 0.09
74 0.07
75 0.07
76 0.07
77 0.07
78 0.07
79 0.07
80 0.07
81 0.05
82 0.05
83 0.05
84 0.04
85 0.03
86 0.03
87 0.03
88 0.02
89 0.03
90 0.03
91 0.03
92 0.04
93 0.04
94 0.04
95 0.04
96 0.06
97 0.07
98 0.09
99 0.13
100 0.15
101 0.18
102 0.23
103 0.24
104 0.24
105 0.25
106 0.24
107 0.31
108 0.31
109 0.34
110 0.32
111 0.38
112 0.4
113 0.38
114 0.38
115 0.3
116 0.31
117 0.25
118 0.23
119 0.17
120 0.13
121 0.13
122 0.11
123 0.09
124 0.06
125 0.05
126 0.03
127 0.03
128 0.03
129 0.03
130 0.03
131 0.03
132 0.04
133 0.04
134 0.07
135 0.09
136 0.09
137 0.1
138 0.1
139 0.11
140 0.11
141 0.12
142 0.16
143 0.24
144 0.26
145 0.25
146 0.26
147 0.26
148 0.26
149 0.26
150 0.2
151 0.17
152 0.19
153 0.22
154 0.22
155 0.22
156 0.23
157 0.28
158 0.3
159 0.28
160 0.27
161 0.3
162 0.35
163 0.37