Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P7B7J5

Protein Details
Accession A0A0P7B7J5   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
81-105EELKIRGKSAPKKKKGPPVPTGKKRBasic
NLS Segment(s)
PositionSequence
84-105KIRGKSAPKKKKGPPVPTGKKR
Subcellular Location(s) mito 20.5, cyto_mito 12.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MSVPRARVLDLMKAQCQVFATSFNPNGARMGNKVLRQRLKGPAMAAYYPRKAATIKDLKREFGPVLGTWDEAEEDRFEYIEELKIRGKSAPKKKKGPPVPTGKKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.33
3 0.32
4 0.26
5 0.19
6 0.19
7 0.18
8 0.21
9 0.22
10 0.23
11 0.22
12 0.21
13 0.21
14 0.19
15 0.19
16 0.15
17 0.21
18 0.23
19 0.27
20 0.32
21 0.39
22 0.43
23 0.44
24 0.47
25 0.48
26 0.47
27 0.44
28 0.39
29 0.34
30 0.31
31 0.29
32 0.28
33 0.24
34 0.21
35 0.21
36 0.2
37 0.17
38 0.15
39 0.15
40 0.21
41 0.27
42 0.29
43 0.37
44 0.38
45 0.39
46 0.39
47 0.41
48 0.32
49 0.23
50 0.22
51 0.14
52 0.16
53 0.16
54 0.15
55 0.13
56 0.13
57 0.12
58 0.1
59 0.11
60 0.07
61 0.08
62 0.08
63 0.08
64 0.07
65 0.08
66 0.09
67 0.13
68 0.13
69 0.15
70 0.18
71 0.2
72 0.21
73 0.24
74 0.32
75 0.37
76 0.47
77 0.56
78 0.62
79 0.7
80 0.78
81 0.85
82 0.87
83 0.86
84 0.85
85 0.85