Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6FWC9

Protein Details
Accession Q6FWC9    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
156-182QHKLETLKLRRKQRRLRSKLRSKGVDDBasic
NLS Segment(s)
PositionSequence
163-178KLRRKQRRLRSKLRSK
Subcellular Location(s) nucl 20.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR000504  RRM_dom  
Gene Ontology GO:0005685  C:U1 snRNP  
GO:0071004  C:U2-type prespliceosome  
GO:0030619  F:U1 snRNA binding  
GO:0000398  P:mRNA splicing, via spliceosome  
KEGG cgr:CAGL0D01166g  -  
PROSITE View protein in PROSITE  
PS50102  RRM  
CDD cd12247  RRM2_U1A_like  
Amino Acid Sequences MKQENIKTLYLQNLPRRPVNKESFIRNLLKCINRNNIYVLNPSKPIPASIDFNEYNELKESQDKNLYLDESLGLISISLSRSLRLRNQGFLTFESHELAQSFMDRYQNNKLKVSGRIINISFAKKESFLGLYLDNERVLQKALRTKYRKEDLENNQHKLETLKLRRKQRRLRSKLRSKGVDDEQIKAAVTGLTQKVTATINEKKPVPLALKQETRPPKQDNEKLVEPNSILLLTDLPSGCTSDQIKVNIPTKELKEIRLVSVRNVAFVEYEDIEAATVALKEMVPKLTKLGNNIKVTYAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.54
2 0.59
3 0.59
4 0.58
5 0.61
6 0.61
7 0.62
8 0.6
9 0.63
10 0.63
11 0.66
12 0.68
13 0.59
14 0.57
15 0.55
16 0.56
17 0.54
18 0.54
19 0.58
20 0.54
21 0.55
22 0.53
23 0.5
24 0.46
25 0.48
26 0.45
27 0.38
28 0.36
29 0.36
30 0.35
31 0.3
32 0.29
33 0.26
34 0.25
35 0.26
36 0.27
37 0.32
38 0.29
39 0.3
40 0.33
41 0.28
42 0.26
43 0.24
44 0.22
45 0.17
46 0.25
47 0.25
48 0.26
49 0.32
50 0.31
51 0.31
52 0.32
53 0.32
54 0.24
55 0.23
56 0.18
57 0.12
58 0.11
59 0.09
60 0.06
61 0.05
62 0.05
63 0.06
64 0.06
65 0.08
66 0.08
67 0.09
68 0.12
69 0.15
70 0.21
71 0.29
72 0.3
73 0.33
74 0.36
75 0.38
76 0.38
77 0.36
78 0.34
79 0.27
80 0.25
81 0.22
82 0.19
83 0.16
84 0.14
85 0.13
86 0.09
87 0.09
88 0.09
89 0.09
90 0.14
91 0.14
92 0.17
93 0.27
94 0.33
95 0.35
96 0.36
97 0.37
98 0.36
99 0.4
100 0.42
101 0.37
102 0.32
103 0.34
104 0.32
105 0.33
106 0.32
107 0.29
108 0.25
109 0.2
110 0.19
111 0.15
112 0.15
113 0.13
114 0.11
115 0.1
116 0.11
117 0.11
118 0.11
119 0.12
120 0.13
121 0.11
122 0.11
123 0.1
124 0.09
125 0.09
126 0.09
127 0.1
128 0.16
129 0.2
130 0.28
131 0.32
132 0.36
133 0.43
134 0.5
135 0.5
136 0.47
137 0.53
138 0.53
139 0.6
140 0.62
141 0.57
142 0.5
143 0.47
144 0.43
145 0.34
146 0.3
147 0.28
148 0.31
149 0.38
150 0.44
151 0.54
152 0.63
153 0.72
154 0.78
155 0.8
156 0.82
157 0.82
158 0.87
159 0.87
160 0.89
161 0.88
162 0.86
163 0.81
164 0.73
165 0.7
166 0.63
167 0.61
168 0.51
169 0.45
170 0.38
171 0.33
172 0.29
173 0.22
174 0.18
175 0.09
176 0.08
177 0.1
178 0.09
179 0.1
180 0.1
181 0.1
182 0.11
183 0.12
184 0.13
185 0.15
186 0.21
187 0.26
188 0.3
189 0.31
190 0.3
191 0.3
192 0.33
193 0.31
194 0.29
195 0.31
196 0.35
197 0.4
198 0.41
199 0.49
200 0.53
201 0.54
202 0.56
203 0.53
204 0.54
205 0.58
206 0.64
207 0.61
208 0.6
209 0.61
210 0.58
211 0.55
212 0.49
213 0.39
214 0.32
215 0.26
216 0.19
217 0.14
218 0.1
219 0.09
220 0.07
221 0.11
222 0.1
223 0.1
224 0.11
225 0.12
226 0.12
227 0.16
228 0.16
229 0.17
230 0.21
231 0.23
232 0.27
233 0.32
234 0.37
235 0.35
236 0.36
237 0.37
238 0.36
239 0.43
240 0.41
241 0.37
242 0.39
243 0.39
244 0.42
245 0.43
246 0.42
247 0.34
248 0.41
249 0.39
250 0.32
251 0.31
252 0.26
253 0.2
254 0.2
255 0.21
256 0.13
257 0.14
258 0.12
259 0.12
260 0.11
261 0.11
262 0.09
263 0.07
264 0.06
265 0.05
266 0.06
267 0.06
268 0.08
269 0.11
270 0.16
271 0.17
272 0.17
273 0.21
274 0.27
275 0.29
276 0.35
277 0.43
278 0.47
279 0.5
280 0.51
281 0.52