Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0P7B7Z9

Protein Details
Accession A0A0P7B7Z9    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
54-73LGQPRHKSSKKPKPPGPAGEBasic
NLS Segment(s)
PositionSequence
27-69AKKKGEEERRARHKAWAALDRKRARRILGQPRHKSSKKPKPPG
Subcellular Location(s) nucl 15.5, cyto_nucl 13, cyto 9.5
Family & Domain DBs
Amino Acid Sequences MNHERRKQDLHFGIEPFVKTLFGVKDAKKKGEEERRARHKAWAALDRKRARRILGQPRHKSSKKPKPPGPAGEAEDEPDDGPEDEPGDEAPEAPGGDAESDEPEPENEAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.42
3 0.33
4 0.26
5 0.19
6 0.15
7 0.17
8 0.15
9 0.16
10 0.21
11 0.24
12 0.33
13 0.37
14 0.41
15 0.39
16 0.41
17 0.47
18 0.52
19 0.58
20 0.58
21 0.65
22 0.71
23 0.74
24 0.72
25 0.68
26 0.62
27 0.57
28 0.54
29 0.52
30 0.48
31 0.49
32 0.57
33 0.58
34 0.58
35 0.58
36 0.54
37 0.47
38 0.49
39 0.53
40 0.55
41 0.58
42 0.63
43 0.64
44 0.68
45 0.75
46 0.68
47 0.68
48 0.68
49 0.69
50 0.7
51 0.73
52 0.74
53 0.75
54 0.81
55 0.78
56 0.72
57 0.66
58 0.58
59 0.51
60 0.45
61 0.36
62 0.29
63 0.23
64 0.18
65 0.13
66 0.11
67 0.08
68 0.09
69 0.08
70 0.08
71 0.08
72 0.08
73 0.08
74 0.09
75 0.08
76 0.08
77 0.08
78 0.09
79 0.09
80 0.09
81 0.09
82 0.07
83 0.07
84 0.08
85 0.08
86 0.1
87 0.1
88 0.11
89 0.11
90 0.11