Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0P7BBI8

Protein Details
Accession A0A0P7BBI8   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
101-120MIRSNRKKAAKAKAAAKKKNHydrophilic
NLS Segment(s)
PositionSequence
105-120NRKKAAKAKAAAKKKN
Subcellular Location(s) plas 14, E.R. 7, mito 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR009914  DPM2  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0030234  F:enzyme regulator activity  
GO:0019348  P:dolichol metabolic process  
GO:0006486  P:protein glycosylation  
Pfam View protein in Pfam  
PF07297  DPM2  
Amino Acid Sequences MRDNLPALRTVFDNPSTVFKASRLTDLSLSLQLDKIVGLAMLVAASVVFLYYTIWTLLMPFVDGDHPLQNFFPPRVWAIRIPVIIILLGSAVVGSFLAMVMIRSNRKKAAKAKAAAKKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.26
3 0.27
4 0.27
5 0.24
6 0.21
7 0.25
8 0.24
9 0.28
10 0.25
11 0.24
12 0.24
13 0.25
14 0.26
15 0.23
16 0.22
17 0.18
18 0.16
19 0.14
20 0.13
21 0.1
22 0.08
23 0.06
24 0.05
25 0.04
26 0.03
27 0.03
28 0.03
29 0.02
30 0.02
31 0.02
32 0.02
33 0.02
34 0.02
35 0.02
36 0.02
37 0.03
38 0.03
39 0.04
40 0.04
41 0.04
42 0.04
43 0.05
44 0.05
45 0.04
46 0.04
47 0.04
48 0.04
49 0.04
50 0.05
51 0.06
52 0.08
53 0.08
54 0.09
55 0.09
56 0.1
57 0.12
58 0.12
59 0.12
60 0.11
61 0.13
62 0.15
63 0.17
64 0.17
65 0.2
66 0.23
67 0.22
68 0.21
69 0.2
70 0.17
71 0.15
72 0.13
73 0.09
74 0.04
75 0.04
76 0.03
77 0.03
78 0.02
79 0.02
80 0.02
81 0.02
82 0.02
83 0.02
84 0.03
85 0.03
86 0.03
87 0.06
88 0.1
89 0.17
90 0.21
91 0.25
92 0.33
93 0.38
94 0.46
95 0.52
96 0.59
97 0.62
98 0.67
99 0.73
100 0.76